KEGG   Trypanosoma brucei: Tb927.3.4850Help
Entry
Tb927.3.4850      CDS       T01013                                 

Gene name
Tb03.48K5.550
Definition
enoyl-CoA hydratase, mitochondrial precursor (EC:4.2.1.17)
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
tbr  Trypanosoma brucei
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:tbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tb927.3.4850 (Tb03.48K5.550)
   01212 Fatty acid metabolism
    Tb927.3.4850 (Tb03.48K5.550)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Tb927.3.4850 (Tb03.48K5.550)
   00650 Butanoate metabolism
    Tb927.3.4850 (Tb03.48K5.550)
  Lipid metabolism
   00062 Fatty acid elongation
    Tb927.3.4850 (Tb03.48K5.550)
   00071 Fatty acid degradation
    Tb927.3.4850 (Tb03.48K5.550)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Tb927.3.4850 (Tb03.48K5.550)
   00310 Lysine degradation
    Tb927.3.4850 (Tb03.48K5.550)
   00380 Tryptophan metabolism
    Tb927.3.4850 (Tb03.48K5.550)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Tb927.3.4850 (Tb03.48K5.550)
Enzymes [BR:tbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Tb927.3.4850 (Tb03.48K5.550)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 267 aa AA seqDB search
MLRSCALLRSATEAVVKCSQRGAVLTLTLNRPAQLNALNKDLLCALAESVSKYDADPSVS
VIIITGEGKAFCAGADVKAMSSKSFVDFYKDDMLRGIDTVANAKKPVIAAVNGFALGGGC
ELVMSCDIVVASEKATFGQPEVKIGTIPGAGGTQRLARLIGKSKAMEWVLTGQQYTAEEA
ERAGLVSRVVKHEELTTATMSVAEKITLNSCLITSLAKDCVNRGFEATLSEGLNYERRIF
QATFATADQKEGMRAFLEKRKPFFTNS
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgttacgctcctgtgcacttttacgttctgcaacggaggctgtcgttaagtgctctcag
agaggagctgtgttgacgctgacacttaacagacctgctcaacttaatgcacttaacaag
gatttgttatgcgcgctagctgaaagcgtgtcgaagtacgatgcggatccgtcggtgtcg
gtcatcatcattaccggtgagggtaaagccttctgtgccggtgctgatgtgaaggcaatg
tcaagtaaaagttttgttgacttttataaggacgacatgcttcgcggtatcgacactgta
gctaatgctaagaaaccagttattgccgcagtcaacggtttcgctttgggcggtggatgt
gaacttgtcatgtcttgcgatatcgttgtagccagcgaaaaggcgaccttcggacaaccc
gaagttaaaattggaacaattccgggcgctggcggtacacaacggcttgcgcggctaatt
ggtaaaagtaaagcgatggaatgggtgctgacgggacaacagtatactgcagaagaggcg
gagcgcgctggtttggtttcccgtgttgtgaagcatgaggaacttaccacggcaactatg
tcagtcgctgaaaaaattacgttgaacagctgcttaataacttcccttgcgaaagattgt
gtcaatagggggtttgaagcaacactgagcgagggcctaaattacgagcgacggatattc
caggctacatttgccacagctgaccaaaaggaaggtatgcgtgccttcctggagaaaagg
aaaccgttcttcaccaattcgtag

DBGET integrated database retrieval system