KEGG   Trypanosoma brucei: Tb927.4.1360Help
Entry
Tb927.4.1360      CDS       T01013                                 

Gene name
Tb04.2L9.540
Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
tbr  Trypanosoma brucei
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tbr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tb927.4.1360 (Tb04.2L9.540)
Enzymes [BR:tbr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Tb927.4.1360 (Tb04.2L9.540)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 293 aa AA seqDB search
MAKSPIVARNDDGSSILVHLQGAHLTNWRNKEGTELLYTSSKAVYEKGIPIRGGVPIVFP
QFGNMGPLPPHGFARVRMWAVKEVTNGSASFTLNVPLRDLLGHDSGMIAEAPIAEAPSAE
TETVALLYTITFSNSHLDLQMEILNQHPTSVAEFTFAFHTYFAVGNVEKTVVEGVNMTSY
VNNMAPHQGVLPPRRLWIIKKETDRTYFNQACAVLLVDAMKGHTVHVSGENLPDVVVWNP
HVEKSKKLKDLPADGYKEFVCIEHGVIAKRVKLQPQFEWKGRQRILVLPSSKM
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaatctcctattgtggcacgaaacgatgacggttcctccatcttagttcatttg
cagggcgcccacctcaccaactggcgcaacaaggagggcacagaactcttgtacaccagc
tccaaagccgtctatgagaagggaattcccatacgcggtggtgtcccaattgtttttccg
cagtttggaaacatgggaccgctgccgccacatggcttcgcgcgcgttcgtatgtgggct
gtgaaggaagtaacaaatggttctgcttccttcacactcaacgtgcctcttcgcgatttg
cttggacacgactccggcatgattgctgaggcccccattgcggaggcaccgtcggccgaa
accgaaacagtcgcacttctctacacaatcacattcagcaacagtcatttagacctgcag
atggaaatattgaatcagcatcccacgagcgtggcggagtttaccttcgcgtttcacaca
tacttcgcggtgggaaatgtggagaaaaccgtggtggagggggtgaacatgacctcatat
gttaacaacatggctccccaccagggtgtgctgccgccaaggcggttgtggataataaag
aaggaaacggaccgcacatacttcaaccaggcttgtgccgtgcttctggtagacgcgatg
aaggggcacacggtccatgtttcaggagaaaaccttccagacgtcgtcgtatggaaccct
cacgtggagaagtcaaagaagttgaaggacctcccggcagacgggtacaaggagtttgtt
tgcatcgagcacggtgtcattgccaagcgagtgaagctgcagccccagtttgaatggaag
ggacggcagcgtatccttgtgcttcccagttctaaaatgtaa

DBGET integrated database retrieval system