KEGG   Trypanosoma brucei: Tb927.4.1860Help
Entry
Tb927.4.1860      CDS       T01013                                 

Gene name
Tb04.29M18.160
Definition
(RefSeq) ribosomal protein S19
  KO
K02966  
small subunit ribosomal protein S19e
Organism
tbr  Trypanosoma brucei
Pathway
Ribosome
Module
Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:tbr00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    Tb927.4.1860 (Tb04.29M18.160)
Ribosome [BR:tbr03011]
 Ribosomal Proteins
  Eukaryotes
   Small subunit
    Tb927.4.1860 (Tb04.29M18.160)
  Archaea
    Tb927.4.1860 (Tb04.29M18.160)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
4
AA seq 167 aa AA seqDB search
MAVARTKANSKIRRIGKKKGATLRDVHPWRWVKICSQHFKQEGKMMVPNCAEIVKTSHGR
ERAPQNPDWYYIRCAAVLRAVYLRPGVGYGGLSKRFSSKKNRGSRPEITTRASKGLLHWC
CKSLTKLELLEKCKGAGHRVTKLGRKVADTIAFKIALRKMGAETKAK
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcgctcgcacaaaggctaattccaagatccgccgcatcggaaagaagaagggc
gcgactctgcgtgatgttcacccatggcgctgggtgaagatctgcagccaacatttcaag
caggagggtaaaatgatggtaccaaactgtgcagaaattgtcaagacttcacacggccgc
gagcgcgccccgcagaatcccgactggtattacatccgttgcgccgctgtgctccgtgcg
gtgtacctgcgccctggtgtgggatatggtggcctcagtaagcgcttctccagcaagaaa
aaccgcggaagccgtcctgagattacaactcgcgcttcaaaaggtctccttcactggtgt
tgcaagagccttaccaagttggaattgcttgagaaatgcaagggagctggacatcgtgtt
actaaactcggtcgcaaggtggcagacaccattgccttcaagattgccctccgcaagatg
ggcgctgagacaaaggcaaagtaa

DBGET integrated database retrieval system