KEGG   Trypanosoma brucei: Tb927.4.1950Help
Entry
Tb927.4.1950      CDS       T01013                                 

Gene name
Tb04.29M18.580
Definition
NADPH--cytochrome p450 reductase (EC:1.6.2.4)
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
tbr  Trypanosoma brucei
Brite
Enzymes [BR:tbr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     Tb927.4.1950 (Tb04.29M18.580)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 610 aa AA seqDB search
MEENEGIGTITILYGTQTGSAEQLAFTFASLAIKRGFKRCVCLPADEFPLDKWRDATPLV
IICSNANQGEAPDSIRISWAQLLHSTAPSMDGLRFAVFGTGDSIYPKFNYMAKMLHNRLR
QLGGTPLLNRGLGDESDRKGYDEVFLPWVLELWRALGLVSEDDSHLKEENPSDAPLLCKY
EVVPCNDESAPQGGVDVAVRRREPVFNCRLVQNKRLTAEDHLQAVHHIAFSRETTPAEGS
LLPYDTPLAFEVGDALGVYCTNEDAIIDRVLTQVNEDGDKVVCIKPNNSQGIIQQQEQPF
FNRPMTLRFFLKHYVDLEAVVSRSFFRMMAHYAEDAELKERLWELSSSDNLDDFMWYCQR
EKRNVAEVLDDFRAVRPPLALLLSFMPPMRARLFSISSSPYVDCDTFHLTVALVEWQTPY
KRTRRGLCSSRLTSAKPGDVFTCFLWDGTMITPSTPAPLLCVGTGTGVAPIRSLIRECAG
HSDIWGEVPILLFFGCRNETKDYLYQQEWADLKRDHLKQLQVLPAFSRDGEKKFYVQHQI
GRHARRVAKLLDAGATIYVCGNSKQMPKDVATTLEDVVTQCCCEGDEAKSQEYMKQLRKQ
GRYVVDTWSV
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaaatgaagggattggaactataaccattctctacggcactcaaacgggttct
gcagagcagttggccttcacgtttgcttctctggccataaaacgtgggttcaaacgctgt
gtttgtcttcctgccgacgaattcccgctcgataagtggcgtgatgccacaccgctggtt
attatatgttcaaatgccaatcagggcgaagctccggattctattagaatttcgtgggca
cagctactgcattccacagctccatccatggacggattgcgcttcgctgtatttggaacc
ggggactcaatttatccaaagttcaattacatggcgaaaatgcttcacaacaggcttcgg
caactcggaggcactccgcttttaaatcgcggtcttggggatgagagtgacaggaagggc
tatgatgaagttttcctgccatgggtgctggaactgtggcgcgctctaggtttggtaagt
gaagatgacagtcatctcaaagaggaaaatccttccgacgcacctcttctatgcaagtac
gaggtggttccttgtaatgatgagtccgcgccacaagggggcgtggatgtggcagttcgt
agacgggaaccagtgtttaactgcaggttagttcagaacaaacggcttacagcggaagat
catttacaggcggtgcatcatattgctttctcgcgtgaaactacgcccgctgagggaagc
ttgctaccatacgacactcctcttgcttttgaagttggagacgcactgggagtgtactgt
actaatgaggatgctatcatcgatagggtactgacccaagttaatgaggacggggacaag
gtggtttgtataaaacccaacaactcacagggtattatccaacaacaggagcaaccgttt
tttaatcgaccaatgacgcttcggttctttttgaagcattacgtggacctggaagcggtg
gtgagtcgttcatttttcagaatgatggcccactacgctgaggatgctgaactcaaggaa
agactgtgggaactctcgtcatcggataacttggatgattttatgtggtactgccagcgg
gaaaaaaggaatgttgcggaagttctggatgacttccgagctgtgcgaccgccgctagca
ttgttgcttagtttcatgccgcccatgcgtgcccgccttttttccatttcctcctcaccg
tatgttgactgcgacactttccacctcactgtcgcacttgtggagtggcaaacaccttac
aaacgaactcgcaggggattatgcagctcccgtcttacctcagcgaagcccggcgatgtc
ttcacttgcttcctttgggatggcacgatgattacgccctccacaccggccccgctgctg
tgtgttggaactgggactggtgtggcgcctatacggtccttaattcgcgaatgtgctggg
cactctgacatttggggtgaggtccccatccttcttttcttcggatgccggaacgagacg
aaggactatctgtatcagcaggagtgggccgacttaaagcgcgaccacctgaagcagctg
caagttcttcccgcattttctagggatggagagaaaaagttctacgttcaacatcaaatt
ggtcgtcacgccagacgggtcgcgaagttgctggatgcaggagcaaccatctatgtgtgt
ggtaattcgaaacaaatgcccaaagatgttgccacgacactcgaagatgtcgtcacacag
tgctgttgtgaaggagatgaagcgaagagtcaggagtacatgaagcaactgaggaaacaa
ggaaggtatgtggtggatacatggtctgtgtag

DBGET integrated database retrieval system