KEGG   Trypanosoma brucei: Tb927.4.2450Help
Entry
Tb927.4.2450      CDS       T01013                                 

Gene name
Tb04.1H19.870
Definition
thioredoxin
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
tbr  Trypanosoma brucei
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 411 aa AA seqDB search
MKRPSFLLVSLLFLAIGSTVIEAFPFTASSGVVELTPATFNSFLGSHKPVFILFYAPWCG
HCKRLHPEWEKFAKSVEGIVRVGAVNADEHQQLGQQFNLRGFPTVKFWGLGEKRANAAMD
YAGERSAGAIQSQAISLINAPGIKTVKKAEELREAAQAAPEKKAVVLFSAKSRVPPIYAV
LSLSPRLKSMPFYFAGEQEKSGFASEFGVSKLPAIVVLNTTAGEVKPVIYPGKKVAYEPI
AKFLLACANDAYDEANFSLEGGESEQATKKGAAKLALPVRPLPASAHGLENFCSPDARKK
AERTPLCVISLTSEFSLNDVHKTFSNEPLVFFEAGDARDILLGALRGKLGLEKIADKLKD
DKEHNALLLRASKQGTVHYRLVGGVNTAETLSSVLQMVVSGEISLTKEQPK
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcccttcttttcttcttgtgagccttttgtttttggcaattggcagcactgtc
atagaagccttccccttcacagcctcctctggtgttgtggagctaacccctgcgactttc
aacagcttcctcggctctcacaaacccgtttttatccttttctacgcaccgtggtgtggg
cactgcaagcgccttcacccggagtgggaaaagtttgccaaatctgtcgagggaattgtt
cgtgtgggtgctgtgaatgccgatgagcaccagcaacttggccaacaattcaacctgcgc
ggtttccctacggttaagttttggggtttgggagaaaagcgtgccaatgcagctatggac
tacgccggtgagcgcagcgcgggagccattcaatcgcaagccatcagtctcatcaatgca
ccaggaatcaagacggtgaaaaaagctgaggagctacgcgaggcggctcaggcggcacca
gagaagaaggctgttgtactattcagtgctaaaagccgcgtgccgccaatttatgccgtt
ctttcgctctcaccccgactcaagtcgatgccgttttactttgcaggggagcaagaaaag
tctggattcgcttcagaatttggcgtaagtaaacttccagccattgttgtcctcaacacc
accgctggcgaagtgaagccggtgatatacccggggaagaaagttgcttatgagcccatt
gcaaagtttttactggcctgtgcaaacgatgcttacgatgaggctaacttctccttggag
ggtggtgagagtgagcaagctacaaagaagggtgctgcaaagttggcgctgccagtccgg
ccgctccccgcgtcagctcatggtctcgagaatttttgctcccctgacgcacggaagaag
gctgagcgaacgccactgtgtgtgatttcactcacttctgagttttcgcttaacgacgtg
cataaaaccttcagcaatgagccacttgttttcttcgaggctggggatgctcgtgatatc
cttcttggggcccttcggggaaagctgggactagagaagattgcagacaaactgaaggac
gacaaggaacacaacgcacttctgcttcgcgcctccaagcagggcaccgtacactacaga
ctcgttggaggcgtaaacacagctgaaactctcagctcagtcttacaaatggttgtatca
ggcgagatatccctcacgaaggagcagccgaagtaa

DBGET integrated database retrieval system