KEGG   Trypanosoma brucei: Tb927.4.360Help
Entry
Tb927.4.360       CDS       T01013                                 

Gene name
Tb04.5D20.430
Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
tbr  Trypanosoma brucei
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:tbr00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 280 aa AA seqDB search
MEPDTDAAQRLKEEQEIRERDLKRQKEKEERERRAAAEREAEENRRREAEERRIEEEKRR
KRQEEEWRRLGSDIIQDLPPIPPSVVNDGLVDMWYLDDVTSKPQLCLASLKKGRKRDAPV
PTLQQLKELGIIYFNVSLNDFSVVRQIVKERNYKHTDEVKLSQTCKDEQFLERWYQEHYN
EDEQIRIVVDGSCFIDVRSKQDKWIRIHAKTGDLFVFPPGLYQRGTLDEDDFVALYRIFR
DSTRFAPIFRSNPRAESQKVRLNYLMLLKKGNVGKELGFR
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggaacccgacacggatgcggcgcaacgactcaaagaagagcaggagattcgtgagcgt
gatttgaagcgacagaaggaaaaggaggagcgggagcgccgtgcagcagcagagcgtgag
gcagaagaaaacaggcggcgtgaggcggaggaacggagaatagaggaggaaaagaggcgt
aaacggcaggaggaggagtggcgccgacttgggtcggatattattcaagaccttccaccc
attccgccctcggtagtgaatgatggcctcgtagatatgtggtatcttgacgatgtaact
tcaaagccgcagttgtgcctggccagtctgaagaaaggtcggaagcgtgacgcaccagtt
ccgacattacaacagttgaaggaacttggtataatatatttcaatgtgagcttgaacgac
ttctctgttgtcaggcaaattgtgaaggagcgcaactacaaacatacagatgaggtaaaa
ctttcgcagacgtgtaaggatgaacagtttttggaacggtggtatcaggaacactacaac
gaggatgagcagatacgcattgtggtcgatggatcttgcttcattgatgtgcgttccaag
caggacaaatggattcgcattcacgcaaagacgggtgacttgtttgtctttcccccaggg
ctctatcaacgaggaacgctggacgaagatgactttgttgctctctaccgaattttccgt
gattccacacggttcgctcccatctttcgcagtaatccccgtgctgagtcgcagaaagtt
cggcttaactacttgatgttactcaaaaaggggaacgttggaaaggaacttggcttcagg
tag

DBGET integrated database retrieval system