KEGG   Trypanosoma brucei: Tb927.4.3790Help
Entry
Tb927.4.3790      CDS       T01013                                 

Gene name
Tb04.30O21.180
Definition
ubiquitin carboxyl-terminal hydrolase (EC:3.1.2.15)
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
tbr  Trypanosoma brucei
Brite
Enzymes [BR:tbr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Tb927.4.3790 (Tb04.30O21.180)
Peptidases [BR:tbr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Tb927.4.3790 (Tb04.30O21.180)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 465 aa AA seqDB search
MVPVKVKWGRETFELTVDLRSTVKCFKEQLQQLTSVPVERQKIMGVKASQCNDNEVTLEA
AGVAAGKTLMLIGTAAEVVRATPIVATGNKDSAVQAPASHPAEKQAVGLQNIANTCYMNA
AVQMLRLVPEVRDVLNFNANDPIVSELLKLYNTMDTKRDPVVPASLWSILLAHFPTFAEV
NEKGHPMQHDSQEALNALLQRINSCLPESHKRLFTGNLSQKMVCKDDPDDQPVLHDVPFL
MLSCNIDAEIETLEAGLEAAFNETVKLHSEKLAREALHTRTSRIAAMPEYLFIHMVRFSW
RSDIQSKAKILKPVTFPMTLDLHALCAEEYKPELEVERKRVLKRRDIEMERRRAAKNKTK
LDDDEAAPAEDASNTAEPINTTVGNHSGYYELCGVISHKGRSADSGHYVFWGKYADQWMV
LDDSNTAAVSEEDVKRLRGSGEAHIAYVLMYRSRDPRTKQSVIPL
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggttcctgttaaagtgaaatggggtagagaaacatttgaacttacggtggacctcaga
agcaccgttaagtgtttcaaggagcagttgcagcaactcacatcggtaccagtggagcgt
caaaagattatgggagtaaaagcctctcagtgcaatgataacgaggtaacgttagaagcg
gctggcgtagcggccggaaaaacgctaatgctcatcggcaccgctgctgaggttgtaaga
gcaacgccgattgtggctactgggaacaaggattcggcagtgcaagcacctgcttcccat
cctgcagaaaaacaggcggtcggtctgcaaaacattgcgaatacatgttacatgaatgca
gccgtgcaaatgctgcgattagttcctgaagtgcgcgacgtacttaacttcaatgcgaat
gacccaatagtgagcgaacttctgaagctctacaacacgatggacactaaacgtgatcca
gttgtaccggcatctctttggtccattttgttggcccatttccccacatttgctgaagtt
aatgaaaagggtcacccaatgcaacatgattcgcaagaggcccttaacgccttactccaa
cgtattaacagttgcctaccagagtcacataagcgactcttcaccggaaatctatcgcaa
aaaatggtctgcaaggatgatcctgatgaccaacccgtattgcatgatgtcccatttctc
atgctttcgtgcaatattgacgcagaaattgaaactttagaggctggtcttgaagcggcc
ttcaatgaaacggttaaactccactcggagaaacttgcgcgcgaggcccttcacactcgg
accagtcgtatcgctgcaatgcccgagtatcttttcatacacatggttcgcttctcttgg
aggtcagacattcaaagcaaggcaaagattttgaagcccgttaccttcccaatgacgctt
gaccttcatgcgctatgcgcggaggagtacaaacctgaactggaggtggagcgaaagcga
gtgttaaagcggcgggatattgaaatggagcgtcgccgagccgcaaagaataaaacaaag
ttggatgatgacgaagcggcacctgcggaagatgcctccaacactgcggaaccaatcaac
actaccgtagggaatcacagcggttattatgaattatgtggtgttatatctcacaagggg
cgtagcgcggacagcgggcattacgtgttttggggaaaatacgcggatcaatggatggtg
ttggatgacagtaacacggcagcggtttcggaggaggatgtgaagcgacttcggggttca
ggtgaagcccacattgcgtatgtcctcatgtaccgctcaagagaccctcgcacgaagcag
tcggtcattccgctgtag

DBGET integrated database retrieval system