KEGG   Trypanosoma brucei: Tb927.4.800Help
Entry
Tb927.4.800       CDS       T01013                                 

Gene name
Tb04.5E12.820
Definition
hypothetical protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
tbr  Trypanosoma brucei
Brite
Protein kinases [BR:tbr01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   Tb927.4.800 (Tb04.5E12.820)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 2595 aa AA seqDB search
MSNIESPRSSRPFGDSASALTRQFGLVFSNLQNAPDDRPRRVEECLSALLDILVAHALEL
SEHCLIDYIFQLLCDTFGVSISKGVKSLRVVFDVHLGDPHELRCRCFTLLVRKVCETTNE
ADCNTILQEMGEVLRENVRSTSDLLGKHFGRAITTMQSSSVTRAKAVGCQTVATMVDAGA
VVIKRSPALLDLLNTPCSPPCLIHEIMESNDNWHRQALTRLLVNIAESHCIEVTASMAEQ
MASTMTSHLSSATEEKHITGLLTVIDAISASSTLQTVPWSLEAVASFVVQRDWRVYTEDV
RVRAARATGKILPLLVKDEKLYDLVMKNLLSYISGGDEAVALSALTTFRSVIKSLNNIES
HAVLTVDAVSDFIAKSPFNQLAFEILDYLRTQCGEQCVFGVYDLLERADVLNSVEKVAAL
LHFMGNRAPSNVDWLEECNIDLSPDSDVDVLVRSLSFLETLRYTEALESAVGLVFHKHTD
VRRAAVGTVVSLCEVLLSPDKGGSCQGSHVDATITQLNSRVKIAVESLLDVAVTDRQMEI
RYYTLKRLSPVFEPYLVQLDNIDALFMSRNDVCRGVRDQAMLLLYRLHSLQPDILHAQLL
QLQEYMLREIDVKDGSISSTVYHAFLLQMAAENGTILLSPSTVETSVLRRLEKQPFVSKS
LSVALLNLLRAVLDHSGPRNHCDAKQLIQPVLAIVNGSTSSTRRKAAIEALCSILATVPI
TEQSTHVSVYRALSRIIRGEAEESEAVIYSAMKCLSVIGAVDPTKARYIVKALQEGEIAE
EEEVATPALALYKPRLRIHLHMDERYPCIVLYLLVKTLQHSADVEQQASVISVIHSMIHE
VPGRQKAMLLTQFLPQLQAWLADPEKVHLYEVILLLMSDLATLLQRFKDVIPASTGLELL
KSVRLFCLLPQASQKPLNAGVVELLDRVGRGLSPEEMRDHRWAVEFIHQRLLQDKRDLAL
VVRAVKSLDSFLAILHERDFQVLLPHVLGCIEPADAATPNVPGLKKKEVNTACFEFLNQI
MAKQPLLMKDFCSQIIHTITWYIEESDCQDEMEMGLRTLAFLVGIVQRPARRFIKPIQRL
VQQCGLPEDMFTNLLKSAADGLLKARAPLSGHDNLNPELPLTLVSDQPSLSKEDFQQVMK
RVLRLGDHDFEVISVTHSEGNTVVYFRFVQGEDLLLNFRSFTSKAQESQSTLSRNLGILK
LVQNAMSYCQVDDSLLENISRMPVANKKKREQSWMAWLHNTSVVMLKNSPIQPLRCTAQL
AADNTGLSRDLFPFAAAAFIGKLNAQQQEVIIKAFTRALEVSPNDIKQAIFDFAEFIESE
RGKLNPEMILLVEKLTFVVERDNEERKFGINYDEVSGDVVVSHLEPGGPGALAGVPVGAR
LLALNGKRLVTTHEVVGAVKGLNRIELTLECPNGGKRGLSFDCLMDIDVLARVALNSKMY
ARAIFLNEILFAQLLSELSGQVSDRQNAAVRHALEVAERLIEFYNHLGLTMVAKGLVKKM
SEKFSSNIIAPEQFGFDEVGALEQLNWWGEALSRYKSRMNVADGTLDTSAFLGALRCYDA
LGETITMQELIATNWELLDRDAQLEVAPLKAKAALWLGRWDEFDEVVGQPGVMERLDMVE
RCASLFRQKHYGELLDYVDEHRKSLFDSFFESFTESYNRSYDTLVELQHVRHFEELVSFV
KSGSERRKMLRELWHKRVTLMSSRPAHIKTLITINSLVLSPQEDLPSQVVCVRALTKHHW
TSLADHTLSTLLHPNGLNTRLANLDPDVIHVYMKHCYVTRGKQETYTLLSDILNNVQLTA
TSNRAEAWGCCWLLLGEWTVQLFPDCGTKAIETLRTATQLCPENCAAFHSLGILHYDLSR
DPNTSQETQTKHHIESITALFKAVALSRRESNGVMEDVLRILSIWFSHSTVNEVNEAIQE
GIKSVPCYVWLNVIPQLVARIGITGAKARSILTDLLVSIGSNFPHALLYPLTVTEKSPEV
MRRQAAERVLKGIRVTNGPMVEEASLISNEMVRIAILWTEKWHNCIQLAAGKPENVSEIR
NILRPLYEEMKKESTPNEQHFVKVHGSTLRRAWAALQKGESQEAWVLLKQVYCELHKAVG
ERRLQMDDLSPTLVKINKSNVPVPGTFVLGQQLITIQKFHSRVYVMPSKQRPRRFGVDGS
DGSKYRFLLKGHEDLRQDERVMQFIELINTIFSSDSLSNAMGLIIPQYAVIPLTDNVGII
GWVENTETIYKMLERWRKDHNISIYKEVSMIVEKGKLVNITEYHHRNKQERKQLLSHVMA
STPDDELRRIIWDKNDTCEHWLQYRGTYGHTLAIMSIVGYVLGLGDRHLNNLMLQDKGSV
VHIDFGDCFEVAMHRSLYSEAVPFRLTRLLVPALGITGVDGVFRLTCELVMKILRRHSEN
LLSILEAFIYDPLINWRLTTVAEGENSASLLEAPVAGGEASPFAEPDGLIDGPPMQLSRS
VLKVREQAPGTTLEQTGEEETRNTQGDLALARVRAKLTGEDFADGCHVVAGQPSRREVSE
DPNDPFSWWSQGLAESSRDVYMTDGRALPSWSSFRTVNNQENLQNVASQVDRLIEEATSL
DNLAEAYITGWAPFW
NT seq 7788 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatatagagagtccgaggtcatcaaggcctttcggtgacagtgcttctgcactt
acacgccagtttggactagtattttcaaaccttcagaacgcacctgatgaccgcccccgt
cgtgtagaggagtgcctttccgcgctgctcgatatcctcgtggcgcatgcactggagctg
agtgaacattgtttgatcgactatattttccaactgttgtgcgacactttcggtgtttca
attagcaaaggggtcaaatctcttcgtgtcgtgtttgatgtacatttgggggacccacac
gaattgaggtgtagatgttttactcttctcgtacggaaggtttgtgagacaacaaacgag
gcggattgcaacaccattttgcaggaaatgggagaggtgctaagggaaaatgtgcgctcc
acatctgaccttcttgggaagcattttgggcgagccattaccacaatgcagtccagctcg
gttactcgtgctaaggctgtaggttgccaaacggttgccaccatggtggatgcaggggct
gtggtgatcaagcggagtcctgctcttttggacctgctgaacacaccctgctcgccacct
tgtctcatacacgaaatcatggaaagtaacgataattggcaccgccaagcactaacacgt
ctccttgttaacatcgcggaaagtcactgtattgaggtgaccgcctcaatggcggagcag
atggccagcaccatgacgtctcacttatcgtcagcaactgaggaaaaacacataaccgga
ctcttaacggtaattgacgcaatatcggcatcttctactttgcagactgtgccgtggtcg
ctagaagctgttgcttccttcgtggtgcaacgtgactggagggtatacaccgaggacgtt
cgtgttagggccgcacgcgcaacgggaaaaattcttccccttttagtcaaggacgaaaaa
ttgtacgatttggtcatgaaaaatcttttgtcctacatctctggtggcgacgaggctgtt
gccttaagcgcactcaccacttttagaagtgttatcaaatccctcaataatatcgagtcg
catgcagtgctcactgtcgacgctgtgagtgacttcatagcgaaatctccttttaatcaa
ctagcttttgaaatacttgactatttgcgaactcaatgtggagagcaatgtgtttttggg
gtgtatgatttgcttgagcgagccgatgtgctcaacagcgtcgagaaggttgctgcactt
cttcatttcatggggaatcgcgccccatccaatgtggattggctcgaagagtgcaatatt
gatctctcacccgatagtgacgtcgatgtcttggtgcgatccctctctttcctcgaaaca
ctacgatacactgaggcacttgagagcgcggttggtcttgtatttcacaaacacactgat
gtcagacgtgcggctgtcggcacagtcgttagtctttgtgaggttcttctgtctcccgac
aaggggggaagttgccaagggagccatgtagacgccactattacgcaactgaacagtagg
gttaaaattgccgtagagagcctgcttgacgttgcggtgacggacaggcaaatggaaata
cgctactatactctgaaaaggctctcgcccgtgtttgagccatatctcgtccaactggac
aacatagatgctttatttatgtcccgtaatgacgtctgccgtggtgtgcgggatcaggcc
atgttgttactgtacagactccattctttacagcctgacattttgcatgcacagttgttg
cagcttcaagagtacatgttgcgagagattgatgtaaaggatggctctatctcctcgaca
gtttatcacgcctttctcctgcaaatggcggcggaaaatggaacgatacttctgtcccct
agtacagttgagacatcagtgttaagaagactagaaaaacagccgtttgtctcaaagagt
ctttctgttgcactgttgaatctgttgagagccgttctggatcattctggtccacggaac
cattgtgatgcgaaacaacttattcagcctgttcttgccattgttaatgggagtacttcg
tcgactcggcggaaggctgcaattgaggcactttgctcaattttggccactgttcccatt
actgagcaatctacccatgtgagtgtataccgcgcgctctcacggattatacgtggtgaa
gcggaggaaagtgaggctgtgatttactctgccatgaagtgtctgagtgtcattggagcc
gtcgacccgacgaaggctagatacattgtgaaggcactacaagagggtgagatagcagag
gaggaagaggttgcgacacctgcattggccctttacaagccacgactgcgtattcatctg
cacatggacgagcgatatccgtgcatcgtcctctacttgttagtgaaaacccttcagcat
tctgcggatgttgaacaacaagccagtgtcatttctgtcattcattcgatgatacatgag
gtaccaggaagacaaaaggcgatgcttctcacacagttcctaccacaactgcaggcttgg
cttgcagaccccgagaaggtgcatctgtacgaagtaattttacttttaatgtctgacctt
gccactctcttgcagcggttcaaagacgttatccctgcaagcacaggattggaacttttg
aagtctgtccggcttttttgtttgcttccccaggcctcacaaaaacctctcaatgcaggt
gtggtggagttgctagatcgagtgggtcggggactgtcaccggaggaaatgcgcgaccac
cgatgggctgtggagtttatccatcagcggctcctgcaggataagagagatcttgctttg
gttgtccgcgctgtgaagtcactcgactcgttcttagccatactgcacgagagggatttt
caggtgttgttaccccatgtacttgggtgtattgagccagcagacgcagccacaccgaac
gtacccggtctaaagaagaaggaggtgaatacggcctgctttgagttcctcaaccaaatc
atggcgaagcaacctctgctcatgaaggatttttgttcgcaaatcattcacactattact
tggtacattgaagaatccgattgccaagatgagatggagatgggtctccgtacgcttgca
tttcttgtgggcatcgtgcagcgccccgcaaggcgtttcattaaacccatacagcgtctt
gtgcagcagtgtggactcccggaggatatgttcactaatttgttaaagtctgcagcagat
ggtttgttgaaggctcgtgcccccctcagtgggcacgacaatctcaaccctgaacttccc
cttacactcgtttccgaccagccgtcgctatcaaaggaggacttccagcaggtgatgaaa
agggtcctgcgactgggggatcatgactttgaagttatatccgtaacacactcggagggc
aacaccgtcgtctactttcgcttcgttcagggtgaggatttgcttcttaactttcgttcg
ttcacgagcaaggcacaggaatctcagtccaccttgagtcgaaacttgggcatactaaag
ctggtccaaaatgccatgagttactgtcaggttgatgacagcttactcgagaacatatcc
aggatgccagtggctaacaagaagaaacgtgaacaatcgtggatggcttggctgcataac
acttccgttgtgatgctcaaaaattctcccattcagccgctgcggtgcacagcacagctc
gctgcggacaataccggtctttcacgcgatctctttccctttgctgctgctgcgtttatt
gggaaactaaacgcgcaacaacaagaggttataattaaagcctttacacgtgctctagag
gtttctcccaacgacatcaagcaggcaatttttgacttcgctgagtttattgagtcggag
cgcggtaagttaaatcctgaaatgatactcttggtggaaaagctaacttttgttgtggaa
agggataacgaagagcgcaagttcggcattaactacgatgaagtaagtggggacgttgta
gtgtcgcacctggagcctggcggtcccggagctctagcaggtgtccctgttggcgctcga
ctgttggctcttaacggcaagagattagttacaactcacgaggttgttggtgctgttaag
gggcttaaccggattgagttaacattggaatgccccaatggagggaagcgaggactttcc
ttcgactgcttgatggatattgatgtgttagcacgtgtggctttgaattctaagatgtac
gccagagccatattcttgaatgagatcctctttgctcaacttctgagcgaactgagtggt
caggtttctgatcggcagaatgctgcagtgcggcacgcattagaggtggcggagcgcctg
atcgagttctacaaccacttggggcttacaatggtcgcgaagggtctcgttaagaagatg
tcggagaagttctccagcaatattatcgctccagagcagtttgggttcgatgaggttgga
gctctggagcagttaaattggtggggtgaagcactctctcgctacaagtctcgaatgaat
gttgcagatggtaccctcgacacttcggcgttcctgggtgctctacgatgttacgatgct
ctgggtgagaccatcaccatgcaggagctcatcgcgacaaactgggagttactggacaga
gatgcgcaacttgaggtggctccactcaaggccaaagctgctctctggttgggtaggtgg
gatgagtttgatgaagttgttgggcagcctggtgtgatggaacgcttagatatggttgag
cgttgtgcttccctcttccggcagaaacattacggagagcttctggattatgtagatgag
catagaaagtcactttttgattcattcttcgagtcgttcacagaaagctacaatcgctct
tacgatacactggtggagctacagcacgtgcgacactttgaggagcttgtgtcatttgta
aaatcaggaagtgaacggcgaaagatgttaagggaattgtggcataaacgcgtcaccctc
atgtcctctcgaccagcgcatataaagacactcatcaccattaattcattggtgctttca
ccccaggaagatttgccatcgcaggtcgtttgcgtgcgtgctttaactaagcatcactgg
acgtcactagctgaccatacgctaagcactttacttcaccctaacggcttaaacacacgg
ttggccaatttagaccctgatgtaattcatgtgtacatgaagcactgttatgtcaccaga
gggaagcaggagacttacaccttactctccgatatacttaataatgtacagttaactgca
actagtaaccgtgccgaggcgtgggggtgctgttggttgttgctcggtgagtggacggtt
caactcttccctgattgcggaactaaggcaattgagacactgaggactgcaacgcaactt
tgtccagaaaactgtgctgcatttcactcccttggaattttacactacgacttgtcccgt
gatcccaatacatcgcaagagactcaaacgaagcatcacatcgagtcaattaccgcgttg
ttcaaggccgtggctctgtctcggagggagagcaatggtgtgatggaagatgtgcttcgc
attctctcaatttggttttcgcacagcactgtgaatgaggtcaacgaagcaattcaggag
ggcatcaaaagtgtcccgtgctacgtgtggctgaacgttattccacaactggttgcgcgt
ataggcattacgggagccaaggcaaggtctattctcacggatctgcttgtgagtatcggc
agcaacttcccacatgctctcctatatccacttactgtgacagagaaatcacccgaggtc
atgcggcggcaggcggctgagcgtgtgcttaagggtattcgggtcaccaatggccctatg
gtggaggaggcttcactaatcagcaacgaaatggttcgaattgctatcttatggaccgaa
aaatggcacaactgtattcaactggcagctgggaagccagaaaatgtgtcagaaatccgc
aacatcctgcgtcccctctacgaggagatgaagaaggagtcgacacccaatgaacagcat
tttgtgaaagttcacggttcaaccctgcggcgtgcctgggcagcgctacagaaaggggaa
tcgcaggaggcatgggtcctcttgaagcaggtttactgcgaactgcacaaagcagtcgga
gaacgacggcttcagatggatgatttgtcccccacgcttgtaaagataaacaaaagcaat
gtcccggtccctggtacgtttgtgttaggtcagcaactcattacgattcagaagtttcat
tctcgtgtttatgttatgccgtctaagcagcggcctcggcgcttcggtgtagacggttca
gatgggagtaaatatcggtttcttctgaaaggacacgaagatttacgtcaggatgagcgt
gtcatgcagtttattgagttgatcaataccatattctcttcggacagcttatcgaacgca
atgggcttaatcattccccagtacgctgtcattccattaaccgataacgtgggtattatc
gggtgggtggagaacactgaaacgatatacaagatgctagagcggtggcggaaggatcac
aatatttccatctataaagaggtgagcatgatagtggaaaagggaaagttagtcaacatc
acagagtatcatcatcggaacaaacaggagaggaagcagctactaagtcacgttatggcc
agcacccctgatgatgaactgcggcgtattatttgggacaaaaatgatacgtgcgaacat
tggttgcagtacagggggacttacggccacacgttggccataatgtcgattgtgggatat
gtattagggttgggagacaggcatctcaataatttaatgcttcaggataagggatctgtc
gtccacattgactttggtgattgctttgaagtggctatgcaccgttcgttgtattccgag
gcggtgccgtttcgattaactcgtttgcttgttcctgctttgggtatcactggtgttgac
ggcgtttttcgcttgacatgtgaactggtaatgaaaatcctccggcggcactcggagaac
ctcctttcaattcttgaagcattcatttacgatccgctcatcaactggcgtctgacgacc
gttgccgaaggggagaattccgcctcgctattggaggcccccgtggcaggcggtgaagcg
agcccatttgctgaaccagatggcctcatcgatggccctccgatgcagctttcgcggtca
gttttgaaagttcgtgagcaggcacctggaacgacattagaacagactggtgaggaagaa
actcgtaacacgcaaggggacttggctttggcccgcgtccgtgcgaagctgacgggtgaa
gattttgccgatggatgccacgtggttgcggggcagccgtctcgacgggaggtttctgaa
gatccaaacgatcccttctcctggtggtcgcagggccttgctgagtcgtccagggatgtg
tatatgacagatggcagagcgcttccttcatggtcatcattccgaacagttaataatcag
gaaaacttgcagaacgtagcgagtcaagtcgaccgtcttattgaagaagcaacaagtctt
gataatcttgctgaggcatatataactggttgggcaccgttctggtag

DBGET integrated database retrieval system