KEGG   Trypanosoma brucei: Tb927.5.1470Help
Entry
Tb927.5.1470      CDS       T01013                                 

Gene name
Tb05.30H13.600
Definition
NADH-cytochrome b5 reductase (EC:1.6.2.2)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
tbr  Trypanosoma brucei
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tbr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Tb927.5.1470 (Tb05.30H13.600)
Enzymes [BR:tbr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     Tb927.5.1470 (Tb05.30H13.600)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 294 aa AA seqDB search
MVRLALSFAASLTAGVFYAARPSNGIAVDCATKQPSSFSPDKFSAFKLISAQYESPDTRR
LCFGLETAETPFHMPPGACIIARIKDNSGSEITYPFVPITPNNTKGRFEILVKKRLKDKM
SGELFQLRPGEELHVKGPFVKILYKPNMWKSVGMLASGTGIAPMYRMLREILDNPKDNTH
VSLVYANEKRGDILLANELSNLQATFNNFNMYLALQEVPHRWLGGIGEINEEMIRAFMPK
PGERYTKILVAGPPELIKEIAGEKIFNEGMAPEQGPLKGLLKDMGYAESQVFKY
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgactcgccttatctttcgctgcatccctcactgcaggtgtcttttatgccgca
cgtccctctaatggaatagcagtggattgcgcaacgaagcagccatcaagtttcagtccg
gataaattctccgcttttaaactcatatcagcgcaatatgaatcacctgacacgcgccgt
ctttgctttggattggaaacagcagaaacgccttttcatatgccacctggcgcgtgcatc
attgcgcgaattaaggataatagtggaagtgaaataacgtacccttttgtacccattaca
ccaaataacacaaagggacgcttcgaaattttggtcaagaagaggctgaaggataagatg
agtggcgaactctttcaactacggcccggggaggagttacatgtgaagggtccatttgtg
aaaattctttacaaaccaaacatgtggaaaagtgtaggcatgctggcaagcggcacaggt
atagcacccatgtatagaatgttacgagagattttagataacccaaaagataacacacac
gtgtctctcgtgtatgctaatgaaaagcggggtgacattcttttggcgaatgaactatcg
aacctgcaggcgacgttcaacaacttcaacatgtatcttgcattacaagaggtaccacat
cgttggttgggcggtatcggggaaattaatgaagaaatgattcgtgcctttatgccgaaa
cctggggagcgttacacgaaaatcctcgtggcgggacctccagaactaataaaggaaata
gctggtgaaaagattttcaatgagggaatggctcccgagcagggaccactgaaagggctt
ttaaaggacatgggctacgcggagtcgcaggtgtttaaatactga

DBGET integrated database retrieval system