KEGG   Trypanosoma brucei: Tb927.5.2400Help
Entry
Tb927.5.2400      CDS       T01013                                 

Gene name
Tb05.3C6.500
Definition
ubiquitin carboxyl-terminal hydrolase (EC:3.1.2.15)
Orthology
K01072  
ubiquitin thiolesterase [EC:3.1.2.15]
Organism
tbr  Trypanosoma brucei
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 986 aa AA seqDB search
MHHGRKVLEAQKKRDTAPQQEYFPLSKEKVRHDRVHRAEEGKRDRENIGDMNLDDRREDN
RGNCVSGRDASPGSSSRSKGVCSEYQYGEHKRQRLSPEGHDFKVSATQSSHGSTDAYLSS
DRSIGNLRNKSRATDASMRNMVVGTSPLSTGKYNISMRNRATRSALADHDGEFTPKVNAP
PAIGSSGQLPSQATDFHLPLKLYDTMKPSPRVGVGEKYPIKPSFQASHGSRDAYSHGPQL
GMSDMAPAALKRSSAPSYGEVFSGAHVASLSRGRKMEGRNTPRSVRLGEWRTSHSRSGDG
AVSEHAERRHRQANHPLQDHLFAPRRRALEIPPSDPFSFRGISSTESGSHSSSRTGNFTQ
HSEQHDGRVSSSYTQSPETGFEMWRGDKTPYNASQSGSPGCDAGYAPGSTNASSAVESHP
SYLGSLSWAAPHVYQHQQEVPCIPRPHVEYSGFINPENDCYACSVLTLLLRSPLFCRALL
ASPTVECVRPVKSVNNTAATSSSSLTTSYDPTPAGVDHDTVREDPPPVSLHHVLKYFAGL
LQCPQDIEGGIDMRPLRHFFRGNFFSGQQEDAHEFFLAVIDKLTEESKMFLKSTDASGGF
DNPAVEEGEASKEISTDGQGTAAEGTPRSSGNESMPLWINTLITGQLLSIIRCGNAACGH
EIATVDPFINLLVNIRKGEETNETLRQSNPNSSPCQESEHCAPNSEPVGSHGSLLYASPI
SPKPYYDVLSLLTYSFRFSALDSYVCDACGSSNQQLQGGCLLGALPPLLVVQMKRFATTY
SPELGASVTKDVSPVLVNRNIVLYSLDEEHYNREEKTLRSSVLHAEQKAKQHSEGEAVDE
SATHVKATRCSYRLQGVVRHLGKSLYGGHYTTEFAQERVDRKEEEEEEEEEEGDGSTDGT
KDGCGHQVDGERTGEGSVEREKHISSDQCAKRSWYMADDERVSALSEEYSMKEASRSCTC
YLLLYEKVGEEAVSSHVWDILPRGSE
NT seq 2961 nt NT seq  +upstreamnt  +downstreamnt
atgcatcacggtcgcaaagttcttgaagcccagaagaaacgcgataccgcacctcaacag
gaatactttccgctttctaaggagaaagtgagacatgatcgggtccatcgagctgaagag
gggaagcgagatagagaaaatatcggtgacatgaacctcgacgatagaagggaagataat
agaggaaattgtgtttctggaagagatgcttctccgggatcttcttctcgaagtaagggc
gtttgcagtgaatatcaatacggtgagcacaaacggcagcgattgtcaccggaaggtcat
gatttcaaagtttcagccacacagagctcacacggttccacggatgcctatttatcatcg
gatcgatccatagggaatctgcgaaataagtcaagagccacagatgcttcgatgcgcaac
atggtagtgggtacttcaccactatcaactggaaaatataatatctccatgaggaatagg
gcaacgcgttctgccttggctgatcatgatggggagtttactccaaaggttaatgcccct
ccagccatcggttccagcggacaactgccgtcgcaagcgaccgacttccatttaccactt
aaactatacgatactatgaagccgtctccacgtgttggggtgggggagaaatatccaata
aagccatcctttcaggcttcgcatggttcgcgagatgcgtattcgcacggtccacagctg
gggatgtcagatatggcaccagctgcccttaagcggtcaagtgctccatcatacggtgag
gttttttcaggggcgcatgtggcgagtttaagcaggggtagaaaaatggaaggaagaaat
acgccgaggtcagtccgattaggggaatggaggacttcccattcacgcagtggagacggt
gctgtttccgaacacgcggagcggcgtcatcgtcaggcaaatcatccgttacaagaccat
ctttttgcaccccgacgccgtgctttggaaataccgccatccgaccctttttcattcagg
ggaattagttctactgagagcggctcgcattcaagtagtcgcactggcaacttcactcag
cactctgagcaacacgacggccgggtatccagcagctatacgcagagcccagaaacaggt
tttgagatgtggcgtggtgacaaaacgccttacaatgcttctcaaagtggttcgcctggt
tgtgatgctggatacgctccaggaagcaccaatgccagtagcgcggttgagtcgcaccct
tcgtacctgggttccctatcatgggccgcgccgcacgtttaccaacaccaacaggaggtg
ccctgcattccacgaccccacgtcgagtacagtggctttattaaccccgaaaatgactgt
tatgcgtgcagcgtactgacgcttttgttgcgcagccccttattttgtagagcgctgcta
gcttcacccactgtagagtgtgtgaggcccgtaaaatccgttaacaatactgcggcaacc
agtagcagcagtctcacaacatcttacgatccgacacctgcaggcgttgaccatgataca
gttcgtgaggatccacctcctgtaagtttgcatcatgtgttgaaatactttgctggtttg
cttcagtgtccacaggacatagaagggggaatagacatgagaccattgcgacattttttt
agagggaacttcttttctggacagcaagaagatgcacacgaattcttcctcgccgtcatt
gacaaactaactgaggagtctaaaatgtttcttaaatccacggatgcatcagggggattt
gataaccctgcagtggaagaaggcgaagcttcaaaagaaataagtactgatggtcagggt
accgcagctgaagggacaccgcggtcgtcgggtaacgaatcaatgcccctttggataaat
actttgattacgggacagcttctgagcatcattcgctgtggaaatgcggcgtgtgggcac
gagatagcgacggtcgaccctttcattaacctcttagttaatatacgtaaaggagaggag
acaaatgaaacacttcggcaaagtaaccccaacagttcaccttgtcaagaaagcgagcac
tgtgcacccaattccgaacccgttgggtcgcatggcagtctgctgtacgcaagccccatt
tctcccaaaccgtattacgatgtgctgtctctgctcacgtacagcttccgtttttcagct
ctcgattcctatgtttgtgacgcatgtggatcttccaatcagcagttgcagggtggctgt
ctactgggggctctgccaccacttttagtcgtacaaatgaagcggtttgccacaacgtac
tctccagaactgggtgcttctgtgacgaaggatgtgtcccccgtccttgttaatcgaaat
attgtgttgtactctttggatgaagaacattataatcgtgaagagaagacattgaggtcg
agtgtgttgcatgcggaacaaaaggctaaacaacacagtgaaggggaagctgttgatgaa
tcagcaacccatgtgaaggccactcgatgttcctaccggttgcaaggtgtggtgcgtcat
ttggggaaatctctttatggtggccactacacaacggagttcgcgcaggaacgagtggat
agaaaagaagaagaggaagaagaagaagaggaggagggggatggaagtacggatggaact
aaagatggctgtgggcaccaagtcgatggggagcgtaccggagaaggcagcgttgaacgg
gagaaacatataagttcggatcaatgcgcaaaaaggtcttggtatatggcggatgacgaa
agagtttcggcactttctgaagaatattcaatgaaagaagcttcccgttcctgtacatgc
tacttgctgttatacgagaaggtgggggaggaagccgtttcatctcatgtatgggatata
ctcccacggggaagcgagtga

DBGET integrated database retrieval system