KEGG   Trypanosoma brucei: Tb927.5.3820Help
Entry
Tb927.5.3820      CDS       T01013                                 

Gene name
Tb05.6E7.770
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
tbr  Trypanosoma brucei
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tbr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Tb927.5.3820 (Tb05.6E7.770)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Tb927.5.3820 (Tb05.6E7.770)
Enzymes [BR:tbr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Tb927.5.3820 (Tb05.6E7.770)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 327 aa AA seqDB search
MAELQPVTSLKGKSIITAAQFTRPDIDALIRLATALKEKICAGEVLRFLEGRIMTPLFFE
DSSRTLNSFCAAMARLGGRVVYFKAETSSVNKGETLGDTVRTLDSYSDVLVLRHPKQEAI
TEAVAKATHPVLNAGNGAGEHPTQALLDVLTIHSELGRVDGSTIAMIGDLKMGRTVHSLL
KLLVRNFKMKTIFFVAPDALQMPQDVVDSLKQEIAASGVTIRSSNSLTEEILGQCDVLYA
TRLQKERFAAAALDEAKALQAFEAAKADIVINAERMKKAKAKMIVMHPLPRNDELCTSVD
EDPRAAYFRQMQYGMYMRMAILYSVLA
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggcggagctgcaacctgtaactagtttgaaggggaagagcataataaccgcagctcag
ttcacccgccccgatattgatgctctcattcgccttgccactgcacttaaagagaagata
tgtgcgggagaggtgttacgttttcttgagggtcgcatcatgacacctctattctttgag
gattcctcccgcacgcttaattccttttgtgcggccatggcgaggcttggaggtcgcgtt
gtgtactttaaagccgaaacctcctccgtgaacaaaggcgagacactcggggatacggtt
cggacgctggattcctacagtgacgtacttgtgctgcgtcacccaaagcaggaggccatt
acggaagcggttgccaaagctacgcatcccgttttgaatgccgggaatggggccggtgag
cacccaacacaagcacttctcgacgtgttaacaatacattctgaactgggccgcgttgac
ggtagcacaatcgcgatgattggtgatcttaagatgggacgtacggtccactcactactg
aagttgctggtgcgtaactttaaaatgaaaaccatcttctttgttgcgccggatgcactt
caaatgccacaggatgtggtggactcactaaagcaggaaatagcagcaagtggcgtgaca
attcgaagtagcaactcgctgacagaagaaattttgggacaatgcgatgtgttgtacgcc
acccgtctgcagaaggagcgctttgccgcagcggctctggacgaagcgaaggcgttacag
gcatttgaagcggcaaaggcggatatcgttattaatgccgagcgcatgaagaaggcgaag
gcgaagatgattgtcatgcacccacttccccgtaatgatgaattgtgcaccagtgtggac
gaggacccacgcgcggcatactttaggcagatgcagtacggtatgtatatgcggatggcc
atactttacagtgttctcgcttaa

DBGET integrated database retrieval system