KEGG   Trypanosoma brucei: Tb927.6.1110Help
Entry
Tb927.6.1110      CDS       T01013                                 

Gene name
Tb06.3A7.570
Definition
ubiquitin carboxyl-terminal hydrolase (EC:3.1.2.15)
Orthology
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.4.19.12]
Organism
tbr  Trypanosoma brucei
Brite
Enzymes [BR:tbr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Tb927.6.1110 (Tb06.3A7.570)
Peptidases [BR:tbr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Tb927.6.1110 (Tb06.3A7.570)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 1096 aa AA seqDB search
MVSAGSDFLSQQYSIEEGEAERRAQPSLIDILLQLNSPALFRQSQKVTLPCQRDVINFIV
GRISDIGMRVERSRNYVENVSPLGLALVRSALQTAYHNSRMDVFTRSRETGMSRDEVSSE
GSGENNFATADGTIAGIVLSSLAGSAEPSLFAGAVSGFLAFGVNFAKPRQETFSGRGRRR
RRVETATSPLSHDDETDSIESSLPPLDVALWCLHRVAGEILSTAARKISDFKKSPLAQRN
GVPVAAQFFGCHKDPFDCRHNNNGRSEQIVIHLLLQRAYSILKMLHIFALNDTIPADSIP
GCAVGGPAADGSGLYTVSAFCSLLKTSMHNDVPSFVHLITESLGNLAEVTRPVVGDISMV
GRIALEMISEEVWRFTKSTTPHLIFSLACFSVFPALQRCCTPVNMTRDELSTVANLFRGH
IPRLFLDYYKNSSGGADGAGRKQLSSCCPSGEVMKPLYAAPGVKLAPSLDGPRRNADNFE
MADGLGNLAAARRGKESGEAVSAVCQLFLGLRNAGNTCFVNSFLQLLFTAKYFSLELVRG
VLQVLSERGAADGQVGEDAGGNADINSNKKNNVDSTKVTTAVFHKLSRGADELVVMVALI
LSQMHWHLRNGYNSCAIDTYRLQQCLPPPFNDGRQHDTSEFAMALMDRIDNFVFTEKNDN
IEGQDESNEDCSDSGTKFGKRKDEKQRPMLVSRWFGGNLVSTIKCSGCGAARSRRAPFWI
VTVPLRRDGDGAAHVTSSACVAAQGPTANDEREISKSTEIALSADGRVAITTYHTDNASM
RGVESKSDCASCDAEENENNAGVPFQRSLQQLLGRVLNYRESREVLQGENMIFCESCCSN
EQAEMFTAMHGTVNHSAGLGAHFENEEDEQSQGVVEESAVEGIPHYLILQLNRFQYSHAS
ESHEKVMDAVAIEKCLHVPVRVERKSSRSPLHSSQDDGNMGNMITSPDPNAHREERGECD
ELVDIQVQYKLRGVLLHNGPGVYSGHYFSLLFHPSGADSTGKECPEVKGERENDEDGLWA
LANDSHISSVQSKDIDAVLKGSSGVVGPHETPYIVLYERCRKAVGEESGDGRDDTLFPNR
VNDLFHLLRGSAKTAY
NT seq 3291 nt NT seq  +upstreamnt  +downstreamnt
atggttagtgcgggcagtgactttctttcgcagcaatactccatagaggaaggagaggcg
gaacggcgtgcgcaaccatcacttattgatattttgctgcaacttaattcaccagccctt
tttaggcaatctcagaaagttacactaccatgtcaacgcgatgtcataaactttattgtt
ggccgcatatcagatattggaatgcgcgtcgaaaggagtcgtaattacgtggaaaatgtt
tcaccgctagggttagctttggtgcgcagcgccctgcagacggcctaccataattcccgg
atggatgtcttcacccgctcacgggaaaccggaatgagcagggatgaggttagtagtgag
gggtcaggggagaacaattttgcgactgccgatgggaccattgccgggatcgttcttagt
agccttgctgggtcagctgaaccatcgctttttgctggagctgtttctgggtttctcgcg
ttcggcgtcaacttcgcgaagccacggcaggaaaccttcagtgggcgagggagacgaaga
agaagagtagagacagcaacttctcccttatcacacgacgatgagacagacagtattgag
tcatcccttccaccactagacgtagcactttggtgtttgcacagagttgcgggagagatc
ctttcgactgccgcaaggaaaataagcgatttcaaaaagtcaccgcttgcgcaacggaat
ggcgttccggttgctgcgcaatttttcggatgccacaaggatccatttgactgccgtcac
aacaataatgggcgatccgagcaaatagtaatccatttgctactccaaagggcgtactca
atactgaagatgctccatatttttgcacttaatgatacgattcctgccgatagcattcct
gggtgtgcagttggcggcccagccgcggatggcagcggcttgtacacagtgagtgcgttt
tgttccctcttaaagacttcaatgcacaatgatgtgccctccttcgtacacttgataaca
gaatcattggggaacttggccgaggtgacgaggccagtggtcggtgatattagtatggtg
ggacgcattgccctcgaaatgatttcggaagaagtgtggaggtttaccaaatccaccacg
ccacatctcatcttctcccttgcatgctttagtgtgttcccagctctgcagcggtgctgc
acgccggtaaatatgacgagagatgagttgagtacagtggcgaatctctttcggggacat
atcccccgacttttcctagattattacaaaaactcatcaggtggggccgacggtgcgggt
cgaaaacaactttccagctgctgcccgagcggagaggtaatgaaaccactgtatgcggca
cctggtgtcaaattagccccgtcactcgatggccccagaagaaatgccgacaacttcgaa
atggcagacggattaggcaacttggctgctgctcggcgtggtaaggaatcgggagaggcg
gtctctgcggtttgtcaacttttcttgggccttaggaatgctggaaatacatgcttcgta
aatagctttcttcagcttcttttcaccgcgaaatattttagcttggaattggtgcgcggt
gtcctccaggtactcagcgagcgaggcgctgctgatgggcaagttggcgaagacgctggc
ggcaacgctgacatcaacagtaataaaaaaaataatgttgattcaactaaagtgacgacg
gcggttttccacaagctttctcgtggtgccgacgaactagttgttatggtagcacttatt
ctaagccaaatgcactggcatctacgcaacgggtataatagctgtgccattgatacatac
cgtctgcagcaatgtttgccgccgccgtttaacgacggtcgccagcacgatacctccgaa
tttgctatggcattgatggatcgtatcgacaacttcgtgtttacagaaaaaaatgacaac
atagagggacaagatgagagcaatgaagactgctctgattcgggcaccaagtttgggaaa
cgcaaagacgagaagcagcggcccatgcttgtttcaaggtggtttggtgggaacctcgtg
tccaccattaagtgcagtggatgcggagcggcacgctcacggcgggccccattttggatt
gttactgttccactgcgccgtgatggtgacggtgcagcacatgtaacatcatctgcgtgt
gtcgctgctcaggggccaactgccaacgatgagcgggagatttccaaaagtacagaaata
gcactatctgccgatggtcgtgtggccataaccacatatcacacggataacgcttccatg
agaggggtagaaagtaaatctgattgtgcgtcgtgcgacgctgaggagaatgagaataat
gcaggggtgccttttcagcggtccttgcagcaattactcggcagggttctgaactaccgc
gagtcaagggaggtccttcaaggtgaaaatatgatattctgtgaatcttgttgcagcaat
gagcaggcggagatgttcaccgccatgcacggaacggttaatcattcggcagggttaggt
gcacattttgagaatgaggaagatgaacagtcccaaggggttgtggaagagagcgccgtt
gaagggattccacactacctcattttgcagctgaaccgctttcagtactcgcacgcttcg
gagtcacacgaaaaagtgatggacgcagtggctatcgagaagtgtttgcatgttccagtt
cgagtggaaaggaaatcaagtcgctcaccgctccatagtagtcaagatgatggaaatatg
ggtaatatgattacctcacctgatcctaacgcacatcgtgaggagcgtggagaatgcgat
gagcttgttgacatccaagtgcaatacaaactgaggggtgttttgctgcataatgggccc
ggtgtgtactccggacactatttttcacttctttttcatccttcaggcgctgattcaact
gggaaggaatgcccggaggtaaagggggagagggagaatgacgaagatggcttgtgggcg
ttagcaaatgactcgcacatatcgtcggtacagtccaaggatattgatgctgtcctcaaa
ggttccagcggtgtcgtcggaccgcatgagactccgtacatcgttttgtatgaacgctgt
cggaaggccgtcggtgaagaaagtggtgatggacgcgacgatactttattcccaaaccgc
gtaaatgatttgtttcatcttttgcgtggatcagctaaaactgcatattag

DBGET integrated database retrieval system