KEGG   Trypanosoma brucei: Tb927.6.1780Help
Entry
Tb927.6.1780      CDS       T01013                                 

Gene name
Tb06.28P18.710
Definition
mitogen-activated protein kinase (EC:2.7.1.-)
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
tbr  Trypanosoma brucei
Brite
Enzymes [BR:tbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Tb927.6.1780 (Tb06.28P18.710)
Protein kinases [BR:tbr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Tb927.6.1780 (Tb06.28P18.710)
Exosome [BR:tbr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Tb927.6.1780 (Tb06.28P18.710)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 411 aa AA seqDB search
MLTHVSSPDADGRVTYTFNTQWKVEVPRRYEVNNVVGRGAYGIVCSAIDTETGDKVAIKK
IGNVFADVVDGKRTLREVKLLRFLKHPNIISMRDVFRPVSEDFSDVYVVTELMSSDLQTV
VKSPNVQLMSIHCQYLTYQLLCALQYMHSADIIHRDLKPANILTDSDCVVKVCDFGLARG
VGVNVTSYVVTRWYRPPELLLVGDDCDGAVDMWGVACLVAEIVLRCPLFPGRDYIHQLNL
LVDALGLPQVEQDLQHIRSPEALAYLRSLPKRKPLGLEGVHPTLKQAYLTAFSYGTEDDY
EMEGTTTHGNAKDGGSAASEADIAAAAEKEYALFKDFLLKLLLYNPKERMTAAEAVTHPW
LRDIRKKCEDEGLEIQPSNRFHWNFDSAEFTEPVLRAVMKAEIADFSASRR
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgttgacgcatgtgtccagtcccgatgcagacggtcgagtgacgtacacttttaatacc
cagtggaaggtggaggtaccacggcgttatgaagtgaataatgtcgttggccgcggtgca
tatggaattgtatgtagtgccattgacacggaaacgggcgataaggttgctattaagaaa
attggcaacgtgtttgcggatgttgtggatggcaaacgtacgctgcgtgaggtgaagctt
ttgagattcctgaaacatccgaatatcatttcgatgagggatgtctttcgcccagtgagt
gaggacttttctgatgtttatgtggtaacagagctcatgtcatcggatttgcaaacggtg
gttaaatcccctaacgtacaattgatgagtattcattgtcaatatttgacgtatcagctg
ttgtgtgcgctacagtacatgcacagcgcggacattattcaccgtgatttgaaaccagcg
aatatattgacagactcggattgtgttgtgaaggtgtgcgacttcgggctggcgcgaggt
gtcggtgtaaatgtgacatcgtacgtcgttacgcggtggtaccggccgcctgaactgctt
ttggttggtgatgactgtgatggagcggtagacatgtggggcgtagcatgtcttgtagcg
gaaattgtattgcggtgtcctctttttccaggtcgggattacatccaccaactaaacctt
ttagtggatgcgttgggtttgccacaagttgagcaggacttgcagcacatacgctcacct
gaagcgttggcttatttgcgttcattacccaagaggaaaccattaggactggagggcgtt
catccaacactgaaacaggcgtacttaactgcatttagttacggaacggaggatgattat
gaaatggaaggtacaacaactcatggtaatgcgaaggatggcggtagtgctgcttccgaa
gcggatattgccgcggctgctgaaaaggagtatgcgttatttaaagattttctcctcaag
ttgttgttgtacaacccaaaggaacgcatgacggcggcggaggctgtgacgcacccttgg
ttgcgagatatacggaagaaatgtgaggatgagggtttagagatacagccaagcaatcga
tttcactggaatttcgatagtgctgagttcactgaacctgtgcttcgggcagtgatgaaa
gcagagattgcagatttcagtgcttcgagacggtaa

DBGET integrated database retrieval system