KEGG   Trypanosoma brucei: Tb927.6.2690Help
Entry
Tb927.6.2690      CDS       T01013                                 

Gene name
Tb06.5F5.130
Definition
ubiquitin carboxyl-terminal hydrolase (EC:3.1.2.15)
Orthology
K11851  
ubiquitin carboxyl-terminal hydrolase 30 [EC:3.4.19.12]
Organism
tbr  Trypanosoma brucei
Brite
Enzymes [BR:tbr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Tb927.6.2690 (Tb06.5F5.130)
Peptidases [BR:tbr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Tb927.6.2690 (Tb06.5F5.130)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 639 aa AA seqDB search
MRSVADGIGYAGSAEAAADLGSIKSCDNDPQLWMCLRCGLYCCGVHRKSHYDNSRMSGVG
TDDKINGGHRIFFAVKPRWGTDVNSPAVGAPLPTVTINLCQVESPERRTVTMNNLKVSKV
SFEKVGTYGIISCVECHEDPIKLPVRNSLPCLGVDLITLCENVAKVLHCVERNISLAPDY
DEGSFGAPRARGVLDSGIATDTRRQNSNYETYSYVETNKQANSRAATSSNSRCVRARAGT
LVEACISGFENRRNTCYFNSVLQCILQCNTFIDFMIRQKFTGSHTLVHHMSEMIGFMKSG
PCAGDRQGIVDGLARALMGSLSEIVPMFGDGDQQDSQELFITLINGIADELDKGKSEEEK
KGSQRVPFEGMLCTTVTCRGCKNQVKRDEVFMALSIPVTNSVEDSLEKLFERSTLNGDSQ
YACEVCFNKLSPAEQTKKNNDIRAENEARKLRKKANAEAKSLNCLYQDADVETSIGRFNG
SLALHLLRFKCDDRGVYKVPGAVSFPKRLNLSKYIVGSAASGCGDTKMPQTIVQTNVNTH
RSVSRPSNSLVHVSGGDGCTSSVEESTDNRRSQLDLELVGIISHVGSLHGGHYVAHVRSH
TKPSMWFYCDDEEIYTVDESSVFEREQGVYMLFYDQLYH
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagcgttgccgatggaattggttatgcagggagtgctgaagctgctgcggattta
ggaagcatcaaatcatgtgataatgatccgcaactttggatgtgtcttcgctgtgggtta
tattgctgtggagtgcaccgaaagtcgcattatgacaactcgagaatgtctggtgttggc
acagacgataaaataaatgggggccaccgtatcttttttgccgtgaaaccgagatggggg
acggatgtgaactcacctgccgttggtgcaccgttgccgacagttacgataaacttgtgt
caagtcgaatcacctgagaggcgtaccgtaacgatgaataacttgaaggtttcaaaggtt
tcatttgaaaaggtagggacgtatggcattatatcgtgtgtggaatgccatgaagacccg
atcaagttgcctgtgcggaacagcttaccatgtttaggggttgacttgataactctttgc
gaaaatgtagcgaaggtgttacactgcgtcgagagaaacatttctttggctcctgattac
gacgaaggctcgttcggggctccccgtgctcgcggcgtactggattcaggaattgcaaca
gacacgaggcgtcaaaacagcaactatgaaacgtattcttatgtggagacgaataagcag
gccaactcacgtgcagcaacctcttctaacagtcgttgcgtgagagcacgggcgggcaca
ctagtggaggcttgtatctccggctttgaaaatcggcgcaacacatgttatttcaactcc
gttctccaatgtattcttcaatgcaatacctttattgattttatgatccgtcaaaaattc
accggttcacacacgttggtgcatcatatgtccgaaatgatagggtttatgaagagcggc
ccgtgcgcaggtgatagacaaggtatcgtggatggccttgcccgtgctttgatgggcagt
ttatctgaaattgttccaatgtttggtgacggggatcaacaggacagtcaggaactcttc
attacgctgatcaatggtatcgctgatgagttagataagggtaaaagtgaagaagaaaag
aaagggagtcaacgtgtccctttcgaaggtatgctctgtactacagtaacatgcagaggg
tgtaaaaaccaagtcaaacgggatgaagtgttcatggcgctttcaatacccgttacgaac
agcgttgaagatagccttgaaaaacttttcgaaagatcgacacttaacggggattctcag
tacgcctgtgaagtgtgctttaacaaactatctcctgcggagcaaacgaagaaaaacaac
gatattcgtgcggagaacgaggcacggaagctcaggaagaaagcaaatgcggaagcaaag
agtctcaactgtctctaccaagacgcagacgtggaaacatcaatcgggagatttaatgga
tcactcgcgttacacttactacggttcaagtgcgacgaccgtggcgtatacaaagttcct
ggcgcagtttctttcccaaaaagactgaaccttagtaagtatatagtgggcagtgcggca
agcggatgtggggacacgaaaatgccgcaaacgatcgtccaaacaaatgtgaacacacat
cgtagtgtttcccgacccagcaattcgctggtacatgtttccggtggcgatggctgtacg
agtagcgtggaggagagtactgacaaccgacggagtcagttggacttggagctcgtcggc
ataatctcgcatgttggttcacttcacggtgggcattatgttgctcatgtacggagccat
accaaaccatccatgtggttctactgcgacgatgaagaaatttatactgtggatgaatca
agtgtgtttgaacgcgagcagggtgtatatatgctcttctacgaccagctttaccattaa

DBGET integrated database retrieval system