KEGG   Trypanosoma brucei: Tb927.7.1300Help
Entry
Tb927.7.1300      CDS       T01013                                 

Gene name
Tb07.27M11.560
Definition
protein disulfide isomerase (EC:5.3.4.1)
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
tbr  Trypanosoma brucei
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tbr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Tb927.7.1300 (Tb07.27M11.560)
Enzymes [BR:tbr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Tb927.7.1300 (Tb07.27M11.560)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 377 aa AA seqDB search
MTPFSCRKTSLLKAICIFAYFASAAHANEPDAALEGVVDLTSNNFDSSVGKDVAALVEFY
APWCGHCKNLVPEFAKLGRAAAGAKDKVLIAKVDATAQKDLATRFEVNGYPTILFFPAGS
QKPEKYSEGREAKAFVSYLNNQIKGLNLFLPREHKYVMALDQSNFDKVALDEGKDAFVLF
YAPWCGHCKRLHPSFESLAKVYQNEKDLIIANVDADDKSNSEVTKRYKVEGYPTLVFFPK
GNKGNPVNYEEGRTLDDMIKFVNERTGKKRTSSGDFDKTVGVDETVTNLMKEMAQSSKNK
EERERLLAQIQQAVSPKALGEGAMHYIRIATNVLENGHEYISKEHERVGRLLKGSLTGPK
RDSLTIRFNILSAIKGE
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaccccgttttcatgtcgcaaaaccagcctgttgaaagccatttgcatctttgcttat
tttgcatctgcagcgcatgctaacgaaccggatgcggcgctggagggtgttgtagacctc
accagcaataactttgacagtagtgtgggaaaggacgtggcagcgctggtggagttttac
gcgccatggtgtggacactgcaaaaacctcgtaccggagtttgccaaactcggccgcgcc
gccgctggggccaaggataaagttctcattgctaaagtggatgccacagcccaaaaggac
ctcgcaactcgctttgaggtgaatgggtacccaaccattctcttctttcctgctggctcg
cagaagccggagaaatacagcgagggtcgcgaggcgaaggcgtttgtttcgtaccttaac
aaccaaataaagggcttgaacctttttcttccccgtgaacacaagtacgtgatggcgctg
gaccaatccaactttgacaaagtggcactggacgaagggaaagatgcgtttgttttattt
tacgccccctggtgtggacactgcaagcgcctccatccctcgtttgagagtctcgcgaag
gtgtaccaaaacgaaaaggacctcatcattgctaatgtcgacgctgatgacaagagcaac
tctgaggtgacgaagcgctataaggtggagggctaccccactctcgttttctttccaaaa
ggaaataagggcaacccggtgaactatgaggagggacgaaccttggacgatatgatcaag
ttcgtcaatgagagaacggggaaaaaacgcaccagcagcggtgattttgacaaaactgtt
ggtgtcgatgaaaccgtcacgaacctcatgaaggagatggcacagtcaagcaagaacaag
gaggagagggaacgcctcctcgcgcagattcagcaagccgtctcccccaaagctctaggc
gagggtgccatgcactacatccgtattgctactaatgtccttgagaatggtcatgagtat
attagcaaggaacacgagcgtgtcggccgtcttctgaagggaagtctgacaggtccgaag
agggattcgttgacgatccgattcaacattctttcggcaatcaaaggtgagtaa

DBGET integrated database retrieval system