KEGG   Trypanosoma brucei: Tb927.7.2700Help
Entry
Tb927.7.2700      CDS       T01013                                 

Gene name
Tb07.13M20.760
Definition
NADH-cytochrome b5 reductase (EC:1.6.2.2)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
tbr  Trypanosoma brucei
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tbr00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 287 aa AA seqDB search
MKVFAAAAVTGMVASGYFKVDRAVEAKAAAKSPFSQSVYHSYKLVCVQDESHDTKIFTFA
LPEKDMELNFEAPSCITLRYVDDKGKEVVRPYTPLNLESDKGSFELLVKSYPNSRMGSHL
HNMKVGDSIEVQGPWKTMDIKSGQYEHIGMLAGGTGVTPMYQIARNFLGRPSNTTKFSLV
CSNHSKAEMLLADRFGQLANDNPGKLFVFHSLTSPPWYWRGYRGHITKKVIEETMPSPNC
VDKAILLVSGPPGFMKTISGEKQGRSQGPLSGYLKELGYPEAMVYKF
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtatttgcagctgctgctgttactgggatggttgcctctggatattttaaagtt
gatcgagcggttgaggccaaggctgcagcaaaaagtcccttttcccagtcagtatatcac
tcgtataagctggtttgtgtacaggatgaatcacatgacacgaagattttcactttcgcc
cttcctgaaaaggatatggagcttaatttcgaagcgccatcatgtataactctgcggtat
gtggacgacaaggggaaggaagttgtgcggccatacacccctttgaacctggaatccgac
aagggaagttttgagttactggtgaagtcatatcccaactcgaggatgggatcgcacctt
cacaacatgaaggtcggtgactcgattgaagttcagggcccatggaagacaatggatatt
aagtctggtcagtatgagcacattggtatgctggctgggggtactggtgttactccaatg
tatcaaattgcccgtaacttcctcggaaggccctctaatacgacaaagttctcattggtt
tgttccaaccactcgaaggcggaaatgttgttggcggatcgcttcggtcagttggccaac
gataaccctggtaagctgtttgtgtttcattcgctgacgtcaccaccttggtattggaga
ggttacaggggtcatataacgaaaaaagttatcgaagagacgatgcccagtcctaactgc
gttgacaaggcgatattgcttgttagtggtccaccaggttttatgaaaacaatcagcgga
gagaagcaagggcgttcacaaggtcctcttagtgggtatctgaaggaattgggctaccca
gaggctatggtttacaagttttga

DBGET integrated database retrieval system