KEGG   Trypanosoma brucei: Tb927.7.4390Help
Entry
Tb927.7.4390      CDS       T01013                                 

Definition
(RefSeq) threonine synthase, putative
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
tbr  Trypanosoma brucei
Pathway
tbr00260  Glycine, serine and threonine metabolism
tbr00750  Vitamin B6 metabolism
tbr01100  Metabolic pathways
tbr01110  Biosynthesis of secondary metabolites
tbr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tbr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tb927.7.4390
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Tb927.7.4390
Enzymes [BR:tbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Tb927.7.4390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-GeneID: 3658651
NCBI-ProteinID: XP_846062
UniProt: Q57X55
Position
7
AA seq 675 aa AA seqDB search
MLTLRVCGTASVEVKERVVDGLLSVTGPQLFTYPRDGEKGEPSDVFRLCIDQTAAGLYMK
RQSPGEEEEIYDCRFVWGEDSTVEEVITEVTSLVSHRQFSSTRGAVEPSVSFLSVIRDGL
ASDGGLFTLRKIPQVTASQLKYLCTAPNLSYVEAARSLLERLTDMSLKPHILSKHILEAY
DPSRWNGLKDVCPLTPIHPRATSVADVPENHSDWHNMYLLELYHGPTGAFKDFALQLFPR
YFDTAVAAVANQKGGDNNGCGGGEVVSSSTAAGKPLQYMILTATSGDTGVAAISGFVNAK
SPCRVMVFYPLRGVSPVQKMHMISYDNGTTVRVIGVESDFDFCQQSVKKLFADEKLEREL
VNDAGVRLSSANSINWGRLIPQVVYYFWAYRKCIQQNGDKVTGALAFGDKVDFVVPSGNF
GNILAAYVAKLMGLPVGKLIVASNTNDVLYEFVSTGCYDISHRHLVPTASPSIDILKASN
VERFLFILSDGDSKYVSEQMGRLEFEKRFEVCGKVLQRMQETFWSSKCNESNCAAAIKKI
FDATGKLLDPHTAVALHAATEYRREHPETRRPLVIASTAHWAKFPAAVLHAILGEDAVGA
EGVESVTDPAESCKYLYEKVLALCPGEAVHPSLRAVLATVEARSGSLKPRVATRDVSLLR
KEVTGFVVCTSEGSC
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccttacgcgtatgtggcacagcctcagtggaggtgaaggagcgcgtggttgat
ggtctgctaagtgtaacgggtccacagttgttcacataccctcgtgatggtgaaaagggg
gaaccctccgacgtatttcgtctctgtatcgaccaaacggctgccgggttgtacatgaag
cgacagtctcctggagaagaagaggaaatatacgactgccgatttgtgtggggtgaggat
agcacggtggaagaggtcatcacggaggtgacgtcgttggtcagccaccggcagttctcg
tcgactcggggggctgtcgagccttctgtatcgtttctcagtgtcattcgtgacggtctg
gcgtccgacggggggctcttcactctgcgcaagattccacaggtaacggcttcacagctc
aagtacctctgcactgcccccaacctcagttacgtggaggcggcacggtccctgttggag
cggctgacagacatgagcttgaaaccgcacatcctttccaagcacatcttggaggcatac
gatccctcacggtggaacgggttgaaggatgtgtgccctcttacacccatacatccgcgt
gccacgtcggtggcggatgtgccggagaaccactcggattggcataacatgtatctgctt
gagttgtatcacgggccgacaggggcattcaaagacttcgcactgcagttgtttccgcgc
tactttgacacggcggtggcggctgtcgcgaaccagaagggcggtgacaacaatgggtgt
ggaggtggagaggttgtgagttccagcacagccgccggcaaacctctgcaatacatgatt
ctaacagccacttcgggggacactggggtcgcagctatcagcggatttgttaacgcgaag
agtccttgtcgtgttatggtgttttaccccctccgaggcgtgtctccagtgcagaagatg
catatgatttcgtatgacaacggtaccactgttcgcgtcattggtgttgaatcagacttt
gatttttgtcagcaaagcgtaaagaagttgtttgccgacgaaaagctggagagggaattg
gttaatgacgctggcgtgcgcctctcctccgccaacagcatcaactggggccgactgatt
cctcaggttgtatattatttctgggcataccgaaagtgtatacagcagaatggggacaag
gttacaggggcccttgcatttggcgacaaggtggactttgtcgtgccgagtggaaacttc
ggcaacattctcgccgcgtacgtggcgaagctcatgggactccccgtcggcaaactcatc
gtcgccagcaacaccaacgacgttctctacgagtttgtaagtactggctgctacgatatc
agccaccgtcatttggtacctaccgcttctccttcaattgatatattgaaggcgtcaaat
gtggagcggtttctctttatactctctgacggtgattcgaagtatgtttccgagcagatg
ggacgacttgagtttgaaaagaggtttgaggtttgcggcaaggttctgcagagaatgcag
gaaacgttttggtcaagcaaatgtaatgagtccaattgcgctgcggctataaagaaaata
tttgacgcgaccggtaaactgttggacccgcacaccgctgtcgccctccatgcggctacg
gagtaccgacgggagcatccagagacccgacgacccctcgtgatcgccagcactgcgcac
tgggcaaagtttcctgcggcggtgcttcatgctattctcggtgaggacgcggttggagct
gaaggtgttgagtctgtaactgacccagcagagagttgcaagtatctctatgagaaggtg
ctcgcactatgccctggtgaagcagtgcatccgagcctgcgcgcggtactcgctactgtg
gaagcacgatccggctctctcaaaccgcgtgtagcaacacgggatgtgtctcttctgagg
aaggaggtaactggttttgtcgtttgcaccagtgagggctcttgctga

DBGET integrated database retrieval system