KEGG   Trypanosoma brucei: Tb927.7.4390Help
Entry
Tb927.7.4390      CDS       T01013                                 

Gene name
Tb07.26A24.1130
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tbr  Trypanosoma brucei
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tbr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tb927.7.4390 (Tb07.26A24.1130)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Tb927.7.4390 (Tb07.26A24.1130)
Enzymes [BR:tbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Tb927.7.4390 (Tb07.26A24.1130)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
7
AA seq 675 aa AA seqDB search
MLTLRVCGTASVEVKERVVDGLLSVTGPQLFTYPRDGEKGEPSDVFRLCIDQTAAGLYMK
RQSPGEEEEIYDCRFVWGEDSTVEEVITEVTSLVSHRQFSSTRGAVEPSVSFLSVIRDGL
ASDGGLFTLRKIPQVTASQLKYLCTAPNLSYVEAARSLLERLTDMSLKPHILSKHILEAY
DPSRWNGLKDVCPLTPIHPRATSVADVPENHSDWHNMYLLELYHGPTGAFKDFALQLFPR
YFDTAVAAVANQKGGDNNGCGGGEVVSSSTAAGKPLQYMILTATSGDTGVAAISGFVNAK
SPCRVMVFYPLRGVSPVQKMHMISYDNGTTVRVIGVESDFDFCQQSVKKLFADEKLEREL
VNDAGVRLSSANSINWGRLIPQVVYYFWAYRKCIQQNGDKVTGALAFGDKVDFVVPSGNF
GNILAAYVAKLMGLPVGKLIVASNTNDVLYEFVSTGCYDISHRHLVPTASPSIDILKASN
VERFLFILSDGDSKYVSEQMGRLEFEKRFEVCGKVLQRMQETFWSSKCNESNCAAAIKKI
FDATGKLLDPHTAVALHAATEYRREHPETRRPLVIASTAHWAKFPAAVLHAILGEDAVGA
EGVESVTDPAESCKYLYEKVLALCPGEAVHPSLRAVLATVEARSGSLKPRVATRDVSLLR
KEVTGFVVCTSEGSC
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccttacgcgtatgtggcacagcctcagtggaggtgaaggagcgcgtggttgat
ggtctgctaagtgtaacgggtccacagttgttcacataccctcgtgatggtgaaaagggg
gaaccctccgacgtatttcgtctctgtatcgaccaaacggctgccgggttgtacatgaag
cgacagtctcctggagaagaagaggaaatatacgactgccgatttgtgtggggtgaggat
agcacggtggaagaggtcatcacggaggtgacgtcgttggtcagccaccggcagttctcg
tcgactcggggggctgtcgagccttctgtatcgtttctcagtgtcattcgtgacggtctg
gcgtccgacggggggctcttcactctgcgcaagattccacaggtaacggcttcacagctc
aagtacctctgcactgcccccaacctcagttacgtggaggcggcacggtccctgttggag
cggctgacagacatgagcttgaaaccgcacatcctttccaagcacatcttggaggcatac
gatccctcacggtggaacgggttgaaggatgtgtgccctcttacacccatacatccgcgt
gccacgtcggtggcggatgtgccggagaaccactcggattggcataacatgtatctgctt
gagttgtatcacgggccgacaggggcattcaaagacttcgcactgcagttgtttccgcgc
tactttgacacggcggtggcggctgtcgcgaaccagaagggcggtgacaacaatgggtgt
ggaggtggagaggttgtgagttccagcacagccgccggcaaacctctgcaatacatgatt
ctaacagccacttcgggggacactggggtcgcagctatcagcggatttgttaacgcgaag
agtccttgtcgtgttatggtgttttaccccctccgaggcgtgtctccagtgcagaagatg
catatgatttcgtatgacaacggtaccactgttcgcgtcattggtgttgaatcagacttt
gatttttgtcagcaaagcgtaaagaagttgtttgccgacgaaaagctggagagggaattg
gttaatgacgctggcgtgcgcctctcctccgccaacagcatcaactggggccgactgatt
cctcaggttgtatattatttctgggcataccgaaagtgtatacagcagaatggggacaag
gttacaggggcccttgcatttggcgacaaggtggactttgtcgtgccgagtggaaacttc
ggcaacattctcgccgcgtacgtggcgaagctcatgggactccccgtcggcaaactcatc
gtcgccagcaacaccaacgacgttctctacgagtttgtaagtactggctgctacgatatc
agccaccgtcatttggtacctaccgcttctccttcaattgatatattgaaggcgtcaaat
gtggagcggtttctctttatactctctgacggtgattcgaagtatgtttccgagcagatg
ggacgacttgagtttgaaaagaggtttgaggtttgcggcaaggttctgcagagaatgcag
gaaacgttttggtcaagcaaatgtaatgagtccaattgcgctgcggctataaagaaaata
tttgacgcgaccggtaaactgttggacccgcacaccgctgtcgccctccatgcggctacg
gagtaccgacgggagcatccagagacccgacgacccctcgtgatcgccagcactgcgcac
tgggcaaagtttcctgcggcggtgcttcatgctattctcggtgaggacgcggttggagct
gaaggtgttgagtctgtaactgacccagcagagagttgcaagtatctctatgagaaggtg
ctcgcactatgccctggtgaagcagtgcatccgagcctgcgcgcggtactcgctactgtg
gaagcacgatccggctctctcaaaccgcgtgtagcaacacgggatgtgtctcttctgagg
aaggaggtaactggttttgtcgtttgcaccagtgagggctcttgctga

DBGET integrated database retrieval system