KEGG   Trypanosoma brucei: Tb927.7.5480Help
Entry
Tb927.7.5480      CDS       T01013                                 

Gene name
Tb07.10C21.550
Definition
dihydrofolate reductase-thymidylate synthase (EC:1.5.1.3)
Orthology
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
tbr  Trypanosoma brucei
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tbr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Tb927.7.5480 (Tb07.10C21.550)
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Tb927.7.5480 (Tb07.10C21.550)
   00670 One carbon pool by folate
    Tb927.7.5480 (Tb07.10C21.550)
Enzymes [BR:tbr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Tb927.7.5480 (Tb07.10C21.550)
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.45  thymidylate synthase
     Tb927.7.5480 (Tb07.10C21.550)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
7
AA seq 527 aa AA seqDB search
MLSLTRILRKKIPVHELAGKISRPPLRPFSVVVASDEKGGIGDGGTIPWEIPEDMQYFRR
VTTNLRGKNVKPSPSKRNAVVMGRKTWDSLPPKFRPLSNRLNVVLSRSATKEQLLAGIPD
PIKRAEAANDVVAVNGGLEDALRMLVSKEHTSSIETVFCIGGGTIYKQALCAPCVNVLQA
IHRTVVRPASNSCSVFFDIPAAGTKTLEGLELVRESITDERVSTGAGGKKYQFEKLVPRN
SEEEQYLNLVGRIIDEGCTKCDRTGVGTRSLFGAQMRFSLRNNRLPLLTTKRVFWRGVCE
ELLWFLRGETNAKLLSDKGIHIWDGNGSRAFLDSRGLTDYDEMDLGPVYGFQWRHFGADY
ISCKEDSEGKGVDQIANIVKSLIENPDDRRMICTAWNPAALPRMALPPCHMMAQFYVSNG
ELSCMLYQRSCDMGLGVPFNIASYALLTFLMAKASGLRPGELVHTLGDAHVYSNHVEPCR
KQLKRVPRPFPFIVFKQDKEFLEDFQESDIEVIDYSPYPVISMEMAV
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgctcagtcttacgcgtatcctccgcaagaaaattcctgttcatgagttggcggggaaa
atttcccgccctcccctgcgacccttctctgttgttgtagcgtcggacgagaagggtggg
attggggacggtggtacgatcccctgggaaatacctgaggatatgcaatacttcagaagg
gtaacgacaaaccttcgggggaaaaatgtaaagccatcgccaagtaaacggaatgctgtt
gtgatggggcggaaaacatgggacagtcttccaccaaagttccgtccactgtctaaccgc
cttaatgttgtgctgtcacgaagtgcgacaaaggaacagttgttggctggtatccctgat
cccatcaaacgagcggaggctgcgaatgatgtggttgctgtgaacggtgggcttgaagac
gcacttcggatgttggtaagtaaggagcacacatcttctatcgaaacggtgttttgcatt
ggtggcgggactatatataaacaagccctttgtgccccatgcgttaatgtgttgcaagct
atccaccggacggtggtccgaccagcctcaaattcgtgtagcgttttctttgacatccca
gccgcagggacaaagaccctggaaggacttgagttggtgcgggaaagcataacggacgaa
cgggtatcaaccggagctggcggaaagaaatatcagtttgagaagcttgtcccccgaaac
agcgaagaggagcagtatttaaatctcgttggccgcataattgatgagggatgtacgaaa
tgtgaccgcacgggtgttggtacccgctccctctttggggcccagatgcgtttctctctc
cgcaacaatcgcctgccattactaaccacgaagcgtgtcttttggcgtggagtatgtgaa
gagctgttgtggtttcttcggggagaaacaaatgcaaagttgctgagcgacaaggggatt
cacatatgggatgggaatggctcacgagcattccttgacagtcgtggcttgactgattat
gatgagatggacctcggacctgtttatggcttccagtggaggcattttggtgccgactat
atttcttgcaaggaggattccgaggggaaaggtgttgatcagattgcaaacattgtgaag
tcattgatagagaacccggatgaccgtcgcatgatttgtacagcttggaatccggccgcc
ttgccacgcatggcgctcccaccatgccacatgatggcgcaattctacgtgagcaatggg
gaactctcatgcatgttgtaccagcggtcatgtgatatgggtcttggcgtccccttcaat
attgcttcgtatgcactgcttacattcctcatggcaaaagcttctggacttcggccgggc
gaattggtgcacacccttggcgatgcacatgtttacagtaaccatgtggagccgtgtcgg
aagcaattgaaacgcgtgccccgcccgttccctttcatcgtgttcaaacaagacaaagag
ttcctggaagactttcaggaaagcgatatagaggtcatcgattattctccgtaccccgta
atttctatggagatggcggtgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system