KEGG   Trypanosoma brucei: Tb927.7.5790Help
Entry
Tb927.7.5790      CDS       T01013                                 

Definition
(RefSeq) protein disulfide isomerase, putative
  KO
K01829  protein disulfide-isomerase [EC:5.3.4.1]
Organism
tbr  Trypanosoma brucei
Brite
Enzymes [BR:tbr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Tb927.7.5790
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_2 OST3_OST6 Thioredoxin_7 Thioredoxin_8 Thioredoxin_6 AhpC-TSA TraF HyaE Redoxin Thioredoxin_9 ERp29_N
Motif
Other DBs
NCBI-GeneID: 3658786
NCBI-ProteinID: XP_846202
UniProt: Q582J4
Position
7
AA seq 135 aa AA seqDB search
MRNSFALLLLSVAIAFVTVGSFADEAKDSVELTPDNFDKVALDTEKHVFVMFYAPWCGHC
KRLKPKWEELAKEMKDETSVVIARLDADKHRNVAERFDVRGYPTLLLFARSKKEGLRYEG
ARDVAALKEFVKSNM
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgaggaactcatttgcacttctgcttttatctgttgccatcgcttttgttactgttggc
tcatttgctgatgaggcgaaggattccgtggagttaactcctgataattttgataaggtg
gcgttggatacggagaaacatgtgtttgtaatgttttatgcgccatggtgtggacattgc
aaacgtcttaaacccaaatgggaggaactcgctaaagaaatgaaagatgagacatcggtg
gttattgctcgattggatgctgacaagcaccgcaatgtggcggagcgttttgatgttcgc
gggtacccgacacttctgctttttgctcgaagtaaaaaagaaggcctccgctacgaagga
gcccgtgatgtggcagcactgaaggaatttgttaaaagcaacatgtga

DBGET integrated database retrieval system