KEGG   Trypanosoma brucei: Tb927.7.5790Help
Entry
Tb927.7.5790      CDS       T01013                                 

Gene name
Tb07.10C21.170
Definition
protein disulfide isomerase (EC:5.3.4.1)
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
tbr  Trypanosoma brucei
Brite
Enzymes [BR:tbr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Tb927.7.5790 (Tb07.10C21.170)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 135 aa AA seqDB search
MRNSFALLLLSVAIAFVTVGSFADEAKDSVELTPDNFDKVALDTEKHVFVMFYAPWCGHC
KRLKPKWEELAKEMKDETSVVIARLDADKHRNVAERFDVRGYPTLLLFARSKKEGLRYEG
ARDVAALKEFVKSNM
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgaggaactcatttgcacttctgcttttatctgttgccatcgcttttgttactgttggc
tcatttgctgatgaggcgaaggattccgtggagttaactcctgataattttgataaggtg
gcgttggatacggagaaacatgtgtttgtaatgttttatgcgccatggtgtggacattgc
aaacgtcttaaacccaaatgggaggaactcgctaaagaaatgaaagatgagacatcggtg
gttattgctcgattggatgctgacaagcaccgcaatgtggcggagcgttttgatgttcgc
gggtacccgacacttctgctttttgctcgaagtaaaaaagaaggcctccgctacgaagga
gcccgtgatgtggcagcactgaaggaatttgttaaaagcaacatgtga

DBGET integrated database retrieval system