KEGG   Trypanosoma brucei: Tb927.8.1060Help
Entry
Tb927.8.1060      CDS       T01013                                 

Gene name
Tb08.29O4.110
Definition
malonyl-CoA decarboxylase, mitochondrial precursor (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
tbr  Trypanosoma brucei
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:tbr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Tb927.8.1060 (Tb08.29O4.110)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Tb927.8.1060 (Tb08.29O4.110)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    Tb927.8.1060 (Tb08.29O4.110)
Enzymes [BR:tbr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     Tb927.8.1060 (Tb08.29O4.110)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 741 aa AA seqDB search
MLTLVRRPYCSRRMRFPFHLDNISRVSHRYNATDVTLQLSEDRLANWCRRLWALAQGGGD
GDDDGSAVPASNGTTKSGSVFSGRGPHTEFTLVEEMKSVLVGEKGQLPPSVVSAVWDVYE
SIIPPSTLFDLSETISPNQEDAFFSFVALLMELDVDIVEVQAAVAQLNNTIQNIEDLNAQ
SGQFIAGGCSATVSAESCFREENRSGVGAAVLSSKLVKAKNNLLRQCVAALHAGSPVYYM
WFKQSASVERGVRRLMDLRRCVMYFQKRCHCQVAQLQAELKRQHERQSSRQVIDSPPNSG
PLTTNRELELWLLRQHHVSSIDVSLEYLFGDFFSKQWLVMEELTWRTTPPLLLEKVMAAE
SVHPFVGGLVDMKQRLQPAKNRHLFAFFHPAVVEEPLIAVQVALTRGIARSVDIILGRPH
PPSVQERQNDQLGAANGEVADACSGARKHDPVEDVDTSMFYSINSVQSALRGVNLGNMLI
KRVVREIEARLNGERHCAGLSPITTFSTISPVPGYLRWLVGEVAKLQQQVEMRSGSISLC
SSSKKFAQPRIFGECSKPKAAELFSILRGAVLGLSHHRGRGCGHFISRLHYHLREGNEDA
ANLVTMQYLLALFGSPEEDGTGESGAPGKADEDVISPWWNDSEFTRTVEKPLLRSVAHYL
YKEKHRNRILDPVGNFHISNGATMFRLNFLANCTADGSRQSATVMVNYLYEPACVDERVK
AYGMQRSVPIGDDVLRLLNIS
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgttgaccttagtccggcgcccttattgctccaggcgtatgaggttcccttttcactta
gacaacatctcacgggtgtcacatcggtacaacgcaacggatgtcacactacaactgtca
gaggaccgactggcgaactggtgtcggaggctttgggccttagcgcagggtggtggtgat
ggtgatgatgatggttcggcagttcccgcaagtaatggaacgacaaagtcggggtcggta
ttcagtggtcggggccctcatactgaatttacgcttgttgaggaaatgaaatctgttttg
gttggagagaaagggcagctaccgccatctgttgtgtctgccgtgtgggatgtatacgag
tctatcattcctcccagcacgctgttcgacttgagtgagaccatatctcccaaccaagaa
gatgcgttttttagtttcgttgctctgttgatggagcttgacgtcgatatcgtagaggta
caagcggcggtggcgcagcttaacaataccattcaaaatatcgaggacctcaacgctcaa
tcgggtcaatttatcgctggtggatgttctgcgaccgtgtcagcggaaagttgctttagg
gaagagaaccgcagcggtgtgggtgctgctgttttgtcctccaagcttgttaaggctaag
aacaatttgcttcggcaatgcgttgctgcactacatgcgggttctcctgtgtattacatg
tggtttaagcaatctgcttctgtggagcgtggagtgcgcagactgatggatttgcgtcga
tgtgtaatgtattttcaaaagaggtgccattgccaggtggcacagcttcaggccgagttg
aagcgtcaacatgagcggcagtcgtcgcgtcaagtaatcgattcacctccaaacagtggt
ccactgactacgaatagagagcttgaactttggctcctccgtcagcatcatgtctcatct
attgacgtgtcgctggagtaccttttcggcgattttttctcgaagcagtggcttgttatg
gaggaactcacgtggcgtactaccccacctcttctgcttgagaaggtgatggccgccgaa
agcgttcatccctttgttgggggtcttgtggatatgaagcagcggttgcagcctgcgaaa
aatagacacctcttcgcgttttttcacccggcggttgtggaggaacccctaattgctgta
caagtggcccttacgcgtggtattgcccgctccgtcgacattattttaggtcgtccccac
cccccaagcgttcaggagcgccaaaacgaccaattgggggctgccaatggtgaggtggcc
gatgcttgttcaggggcacgaaagcatgatcctgtagaggacgtagacacttccatgttt
tacagtatcaactcggtgcagtcagcactacgtggtgttaaccttggaaatatgctcatc
aaacgtgtagtgcgggaaattgaagcacgactcaacggcgagcgtcattgtgccggcctc
tcacccattaccacattttccacaatttctcccgtccctgggtacttaagatggttggtt
ggagaggtggcaaagcttcagcaacaggtggaaatgcgcagcggaagcatttcgttgtgt
tcttcctcgaaaaaattcgcgcaacctcgaattttcggagaatgctcgaaacccaaggcg
gcggagcttttttcaatacttcgcggcgccgtcctcggtttgtcacatcacagagggagg
ggttgtgggcactttatttcacgacttcactaccacctacgtgaggggaatgaagatgct
gctaacctcgtcaccatgcagtatctgttggctctttttgggtcccctgaggaggatggc
accggtgagagcggtgcccccggcaaagcagatgaggatgtcatttcaccatggtggaat
gatagtgagtttacacgtaccgttgagaaaccgcttctccgctcggtagcgcactatttg
tataaggagaagcaccgtaatcgtattctcgatccggtagggaactttcatatatcgaac
ggggccaccatgttccgactgaattttcttgccaactgcactgcggatggtagcagacag
agtgccactgtaatggtgaattacctctacgaacccgcttgtgtggatgagcgtgtaaag
gcctatgggatgcaacgaagtgtgcctattggggatgatgttcttcgactcctcaacata
tcctaa

DBGET integrated database retrieval system