KEGG   Trypanosoma brucei: Tb927.8.2020Help
Entry
Tb927.8.2020      CDS       T01013                                 

Gene name
Tb08.26N11.490
Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
tbr  Trypanosoma brucei
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tbr01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:tbr00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 331 aa AA seqDB search
MFSKFLMNVKGVTPRGSDWANRLGPVALFGYGAGMPRRAPLLDFFLQSPRDCDHYAELTI
HDKGPIECPPETVMFMPVLNCGQMLDEAAGTETPTSDEWYLGSLEASTELLEKGYVPVSV
GGDGSATLSMVEAYKRLFPSDDIVIVHFSARPSVSDPRSPLRVLLDKGLLKGVVSVGNRQ
VSSEDRKVRKLHKMFYMDMHAIYSKGLFCIRDIRNDYPVFISIDASVLDPAFAPAVDSPV
AGGLSTRDLLHIMNGIRGPKVVGIDVYGYNPDLDVYRKDNVGLTAIALSKIIKEGILKAY
SISTHTEEEGMERVKMLQRQGTVSENPYPDH
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgttctccaagttcctgatgaacgttaagggtgtgacgccccgtgggagcgattgggcc
aatcgactcggtcctgtggctctctttggttacggggcaggcatgccacggcgggctcca
ctcctagacttttttcttcaatcaccacgcgactgtgaccattacgcggagttaactatt
catgataagggcccaattgagtgccctcctgaaactgttatgtttatgcccgttttaaat
tgtggtcaaatgttggatgaagcagcgggaacagagactcccacaagcgacgagtggtac
ctgggatcactcgaggcgtcaacggagctgttagaaaagggctatgttccggtcagcgtg
ggcggggatggctcagcgacgctttcaatggttgaggcgtacaagcgactgttcccatct
gacgacattgttattgttcacttttcggcacgtccatctgtgagcgacccacggtcgccg
ctgagagtgcttttggataaggggttgctaaagggcgttgttagcgtgggtaaccgtcaa
gtgtcatcggaggacaggaaggttcggaagcttcataagatgttttacatggatatgcac
gccatatactccaagggacttttttgcatacgtgatatcaggaatgactaccccgttttc
ataagcattgatgccagcgtgttagaccccgcgtttgcccccgccgttgacagccccgtt
gctggagggctctcgacacgcgatttgcttcacataatgaacggcatccgtggacccaag
gtggtaggaattgacgtttacggctacaaccccgaccttgatgtgtacaggaaggacaat
gtcggccttaccgcaattgcgttatcgaaaataataaaagagggaatacttaaggcatac
agcatatcgactcacacggaggaagaggggatggaacgggttaagatgctacagcgtcag
gggaccgtctctgaaaatccgtaccccgatcattga

DBGET integrated database retrieval system