KEGG   Trypanosoma brucei: Tb927.8.2480Help
Entry
Tb927.8.2480      CDS       T01013                                 

Gene name
Tb08.26A17.360
Definition
3-oxo-5-alpha-steroid 4-dehydrogenase-like (EC:1.3.99.5)
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
tbr  Trypanosoma brucei
Brite
Enzymes [BR:tbr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     Tb927.8.2480 (Tb08.26A17.360)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 335 aa AA seqDB search
MMISQSHSPFTEAGGFAAAVTLLFTAMGMVILSSHLMPLTGTRVLELSSKIHLTMAAGTF
LLLRFALIAPFGKHSGLSTVRIRVPALLSWSLQECPTLLSIIYYIVVEYPCYVHQCNPLQ
WLHMILDRPSMEVTTTVASAAPTLRLGLLFFAVHYFNRSVLYPLRVANHGTSVPLHITLS
AMLYCALNGRLQLLANIDSVDASQRLVVDSTWQTILTILGAVIFFAGMLVNVTSDCYLIR
LKKRPPLGAYKIPYGGLFVFVSCANFFGEIVEWFGYVAVVYGTNGTVAGLAALSFAAYVV
ANLLPRAYAHHQWYIQHFGAEYTALQRRAVIPFVY
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgatgatttcccaaagtcattcgccgttcacggaagcgggcggtttcgctgccgcagta
acccttctttttacggcgatgggaatggtgatactttccagtcacctgatgccactaact
ggcacacgagtattggaactgagtagtaaaattcacttgacgatggccgctggcacgttt
cttctgctccgctttgctctcattgctccttttggtaagcattcggggctaagtacagtg
cgaatccgagtgcctgcattgttgtcatggtccctgcaggagtgccccacccttctgagc
atcatttactacatcgtggtggaatatccatgttatgtgcatcagtgtaaccctctgcag
tggttacacatgattctagatcgtccctctatggaggttacgacaacggttgcctcggcg
gctcctacacttcgcttaggcctattgtttttcgctgttcactacttcaaccgcagcgta
ttgtatccactgcgggttgcaaaccatgggacatccgtgccgttgcacataacgctgagt
gctatgctgtactgtgctctaaatggccggctgcagttgctggccaacatcgatagcgtt
gacgcgtctcaaagacttgttgttgactccacatggcaaacgatacttactattctcggt
gctgtcattttctttgctggaatgcttgtaaacgttacaagcgattgttatcttatccga
ctaaagaagcggcctccgctaggcgcatacaaaatcccatacggtggtcttttcgtgttt
gtcagctgcgccaacttcttcggggagattgtggagtggtttggctacgtcgcagttgtg
tacggaacaaatggaactgttgcaggactcgcagccttaagtttcgccgcgtatgtcgtt
gctaatctcctcccccgtgcttacgctcatcatcagtggtacattcagcactttggtgct
gagtacacagcgcttcaacgccgtgcggtgataccattcgtgtactga

DBGET integrated database retrieval system