KEGG   Trypanosoma brucei: Tb927.8.3310Help
Entry
Tb927.8.3310      CDS       T01013                                 

Gene name
Tb08.28L1.330
Definition
(RefSeq) acetyltransferase (EC:2.3.1.48)
Organism
tbr  Trypanosoma brucei
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 666 aa AA seqDB search
MSLKRPRDEGGHDDLNTGREENAQRNFDSMEEQDQHTPHLSLREARFSGRSMQEGFHLQL
GEYEEPDEAKEVEELMNGHEDFGDLPKERQKALLDAVRVLVRKAAGITNKNQLEHLRVKA
SRLVGFKDTARKSELTAAYRQLVRAGEVQESAAVEELLLRKRGKSHSGVLVVTVFMGPGQ
FSCPKDCHYCPNQPGIARSYLLKEPGVLRGYRNGWDPIRQFYDRASALENNGHVVDKIEL
IILGGTFSFYPKKYVEEFITGNFYAANTYYDSTPLRPIGTLEQEITANEDARCRIIGVTI
ETRPDYINLSELRRFRSLGVTRVQVGIQHLDDDILTIVNRDCPTSKTIVAIKRLLDAGFK
VDAHWMPDLPGSSYSKDHEMFEYLFSEDNENFQVDQWKVYPTATVPYTKIEDWYRTGKYK
PYAELDGGSWMVKLLVYIMENCPRRIRLNRIIRDIPTTYIMGGERRCNLRQVIEAEMKAK
GIRCKDIRERECKGAPVDRNQTKVFVNEFRASGGTEFYLSVENMEQTILYGHLRLRLRDD
SGESNSLVKALEGCALIRELHTYGKLIAVSRPNSGNEAQHMGVGTQLMREAERIAIERGF
MKIAVIAGVGVRRYYAKLGYKLEDTYMVKQLTADKGSTITEEQVEQDDDNDNGGFISMLK
GFMFGK
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctaaagcgccctcgtgatgaaggtggacacgacgacctcaacactgggcgagag
gaaaatgcacagcgaaacttcgatagtatggaagagcaggaccaacacaccccacacctt
tcactaagagaggcgcgtttctccggtcggtccatgcaagaaggtttccaccttcaactg
ggcgagtatgaagagccggacgaagcgaaggaagtggaagagttgatgaacggacatgag
gacttcggcgatttaccgaaggagcgtcaaaaagcattgcttgacgcagtgcgagttttg
gtgaggaaagctgcgggtatcacaaacaagaaccaactggagcaccttcgcgtaaaggcg
tcgcggctcgtgggctttaaagacacggcgcggaagtcagaacttacggcggcgtatcgg
cagttagtgcgtgcgggtgaagtgcaggaatctgcggctgtggaagagcttctcttgcgt
aaacgcggcaaatcgcatagtggtgtacttgttgtaacggtgtttatgggacccggccag
ttttcatgtccaaaggactgtcactactgcccaaatcagccaggtatcgcccgctcctat
ctcctgaaagagcctggtgttcttcgggggtaccgtaacggttgggatcctatcaggcag
ttctatgatcgcgccagtgctctggaaaacaatggccatgtagttgataaaattgagctc
attatcctgggcgggacgttttccttttaccccaaaaagtatgtggaggagtttataacc
ggaaacttctacgcggcgaacacatattatgactccactcccttgcggcctattggtact
ttggagcaggaaataacagctaatgaagatgcgcggtgccgaataattggcgtgacgatc
gagacccggcctgattatataaatttatccgagttgagacgattccgatcccttggtgtc
actcgtgttcaggtcggcatacaacacttggacgatgacattctcactatcgttaaccgt
gactgcccaacttccaaaaccatcgtagccatcaagcggctccttgacgcgggattcaaa
gttgatgctcactggatgcctgacctaccagggagcagctactcgaaggatcatgagatg
tttgagtatttattctcggaggacaatgaaaatttccaggttgatcaatggaaggtgtac
ccaacggcgacggtcccgtacacaaagatcgaggactggtatcgtacgggtaagtacaaa
ccatacgcagagctggacggtggttcttggatggtgaagcttctggtgtacatcatggag
aattgccccaggcggatccgattgaatcgtatcattcgagacataccgacgacatacatc
atgggtggcgagcggcggtgtaatcttcggcaagttattgaggcggaaatgaaggctaag
ggtatccggtgcaaagatatccgcgagcgtgagtgcaaaggggcgcctgtggacagaaat
cagacaaaagtgtttgttaatgagtttcgcgccagtggaggaacggagttttacctttcc
gtggagaacatggaacagacaattctttacggtcatctgcgccttcgcctgcgtgatgac
agtggcgaatcgaattcgctcgtgaaggcactggagggctgcgcactgattcgtgaactg
catacttatggtaagttgattgctgtatcgcggcccaattcgggtaatgaagctcagcat
atgggtgtgggcacacaactaatgcgggaggcagaacgaattgccatcgagcgtgggttc
atgaaaattgcagttattgccggtgtgggtgtccggcgttactacgcaaagcttggctat
aagttagaggacacatacatggtgaaacagctcactgcagataaaggaagcactataacg
gaggagcaagtggagcaggatgacgataatgataatggcggcttcatttctatgctgaag
ggatttatgttcggtaaatga

DBGET integrated database retrieval system