KEGG   Trypanosoma brucei: Tb927.8.3550Help
Entry
Tb927.8.3550      CDS       T01013                                 

Gene name
Tb08.10J17.940
Definition
mitogen-activated protein kinase 3 (EC:2.7.1.-)
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
tbr  Trypanosoma brucei
Brite
Enzymes [BR:tbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Tb927.8.3550 (Tb08.10J17.940)
Protein kinases [BR:tbr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Tb927.8.3550 (Tb08.10J17.940)
Exosome [BR:tbr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Tb927.8.3550 (Tb08.10J17.940)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 371 aa AA seqDB search
MHKSNQELCEPTIVGGFKVYNVGGSEFEVPRKYTLLKILGMGAYGIACSCLNEETQEKVS
IKKCREVFRDLDDGRRVLREVAMMRFFRHENLLHVMDILPPMKGYNEFRDVYIVTPLKDV
DMNVVLRSRQVLEETHVRYFIYQILRGLKYLHSAGVAHRDLKPANLVTDISCELKIIDFG
LSRSVTIPHHDLTDYVITRWYRPPELLLENSYYDTAVDIWSVGCIMAEMYNRKPVLPGRN
TIDQLRLICTHIGKPPRDMVESAEALEKLNQLPDGELDMGKLVPGLTSADGIDFLSQMWE
LDPRKRPSAAELLRHPFMAPLHDEVDEPVCPTSFAWPYEMQEMSLDSLRRAFWDEICSFN
PHLASQIPKGA
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaaagtaatcaagagttgtgcgagcctacaattgtagggggctttaaggtgtac
aatgttggtggatccgagtttgaggttccacggaagtacacacttttgaaaatacttggt
atgggagcttatggtattgcgtgcagttgcttgaatgaagaaacacaggagaaggtatcg
ataaaaaagtgccgagaggtattccgtgacttggatgatggcaggcgcgttctgcgtgag
gttgcgatgatgcgcttcttcaggcacgagaatttgttacatgtcatggatatattgccg
cccatgaagggctacaatgaattccgtgatgtttacatagtaacgcccctgaaggatgtt
gatatgaatgttgtgcttcgctcgcgtcaggtgctagaggaaactcacgtccggtacttc
atttatcaaatacttcggggtttaaaatatttacatagtgccggtgtggcacaccgtgac
ttgaaaccagccaacctagtcactgacatctcgtgcgagctgaagattattgacttcggt
ctttcccgtagcgtcactatcccacatcatgatttgactgactacgtcattacacgctgg
taccgaccgccggaactgcttctagaaaacagttactacgacaccgcggtagacatttgg
tcagtcggttgcattatggcagaaatgtacaatcgcaagccagtccttccgggccgaaac
acgattgatcagctgcggctcatttgcacacatattgggaagcctccaagggatatggta
gagagtgcagaggcgttggagaagttaaatcaacttcctgatggcgaattggacatgggc
aaacttgtgcccgggttgacaagtgcagatggaattgattttctcagccaaatgtgggag
cttgacccgcggaaaaggccatcagcggctgaattacttcgccatccattcatggcaccg
ttgcatgatgaagtggacgagccggtgtgtccgacatccttcgcgtggccatatgaaatg
caggaaatgagtcttgactccctccgtagggcattctgggatgaaatatgcagctttaat
ccacatcttgcaagccaaataccgaaaggcgcgtag

DBGET integrated database retrieval system