KEGG   Trypanosoma brucei: Tb927.8.5120Help
Entry
Tb927.8.5120      CDS       T01013                                 

Gene name
Tb08.5H5.620
Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
tbr  Trypanosoma brucei
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tbr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Tb927.8.5120 (Tb08.5H5.620)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 114 aa AA seqDB search
MPPKERAALPPGDAVRGEKLFKGRAAQCHTGTKGGSNGVGPNLYGIVGRKSGTVEGFTYS
KANQDSGVMWTPQVLDVYLENPKKFMPGTKMSFAGLKKPQERADLIAYLETLKD
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgccaccaaaggagcgtgcagcacttccacccggtgacgcagtgcgtggggagaaactt
tttaagggccgggcggcgcagtgccacacgggtacaaaaggcggttccaacggtgttggg
cctaatttatatggaattgttggccgtaaatccggaactgttgagggttttacgtacagc
aaagccaatcaagattccggtgttatgtggactccgcaggtacttgacgtgtatttggag
aatccaaagaaatttatgcccggcactaaaatgtcttttgcaggtttaaagaaaccacag
gaacgcgccgacctcatcgcatacctcgagacattaaaggactaa

DBGET integrated database retrieval system