KEGG   Trypanosoma brucei: Tb927.8.5620Help
Entry
Tb927.8.5620      CDS       T01013                                 

Gene name
Tb08.26E13.250
Definition
ubiquitin carboxyl-terminal hydrolase (EC:3.1.2.15)
Orthology
K01072  
ubiquitin thiolesterase [EC:3.1.2.15]
Organism
tbr  Trypanosoma brucei
Brite
Enzymes [BR:tbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Tb927.8.5620 (Tb08.26E13.250)
Peptidases [BR:tbr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Tb927.8.5620 (Tb08.26E13.250)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 1419 aa AA seqDB search
MLDLDSWVDEFHAGNEQKAVNQDTCNAAAGSSPSPLSVDVITLAYRLRTPCCVRHTLPSD
CPVGCVASPWCLAGLSTLSTNNTTLQDFVADLLGDDTSLASSHQPQLQRGEHGPNDGDSP
ADTSSVDVYKYPIRRGIRDLGNTCYLNAVLQMLFHIPAVRDEVLRASASFPVAAHNSAKK
ITPLLASGLGELFAEMAYSRDERGVDAERFATFLSIDKGIQQDAQEFFVLLINWLQREVG
DAVRHVFEGTILHDRECSKCGRSCKRAEPFSFLSLPVRQSIEESLEELLRVHEVQGFKCE
ECGAVTSAFSRLHIRTLPDVLVVHFNRFSFSLQEKRREKITRSVSFPIEWDLTPYKDRWR
QVQKQTASNNSGVADSVVEARSNAAQLYRLVGVVNHHGEAAVCGHYTYHGKMDGHGGWYQ
FDNAVVTRLQRFHGTRASSKEAYMLVYERHAHPTNNPLTSAEEDVERAGSLDTTIILPPH
LQNHIERLNHEVEKVRQARQLQRSVVMNFLKQWKDVADDIFYRSARRKGHPIAVMEECED
LTQYVAFPTRWMKLFGRCFIPSYIDTNRYCSFERGMKRHRRNSSKSAVELSNELPAAGSD
SKEVEDNAPLVAAEMVLDTTKGAMPGDCVLIKSIYKSTLTDYLEDVRCPHGKLAPWGQYK
LLSGASARRLNSFLNSVPSLLTSLTTVGEFTPFKGWKLSEYICEECVKRMSKEVQRIKTS
WNEDMEIQTAVTPTSKFAEREDADELVYVSVEAVEHWEQMLKVTEKYRYIVKQQGFTGLV
VAMKARSEDVDTEVIPLPSPSKLLCEHQLLSSVAAVREVPASVWHLLKKRILQLFYGDSV
SVKHTLTPSVKAHMEMLLPYLPVSRTGKCLECIQNKMRMMMERHSAKMEKLNEGKRFSTL
VEASRVMALPSVEVRIRHPNTLVWKRDIKRSYRRCYRTWEREQEDKITAVEARIKSLKEV
GGQREKKQRTLPTPPVRCDRKQSQEPSDSQQVCEVTCENSQSIPDVMEVPSPLQSACDEL
AALRAATPPDVSAVYGCIPTWWVARWYKWYTNDADTGVGPPPCVDYSAFFCQHGGTVLPP
SSLNPTDAHWSKTFTLGPIIRAWKSWLKDPSALDVVEESGSVHFPPIVLVPLKEMIAVLE
RYGGEGQLLPEVTDSKDLVTRLNNGRVVLFVERRGERMLDPPTCEICSTAVLDGVTELSR
GFIDGSLRLRLHLRRSKRQHYDANDVLSGVSYNMTVGKLKVEISQRVLEYHGYILPVNDM
KLLLGRKPLGPNRICKENTCANSDGNAPDGAASPSVASDDRNEESTTGALSTVDVDTCTL
FECGLRDGDEVTVDASNTPLEKVLVNDSLCIRVPGAPTSSSETPTAEDVAAFGATRLYGV
LDNVQNGRERKAPGQKACAVCTYLNVREAERCEMCEAAL
NT seq 4260 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatctagatagctgggtggatgaatttcatgccggaaatgaacagaaagcggtg
aatcaagacacctgtaacgccgctgcgggatcttcaccctctccgttgagtgttgatgtc
atcacgttggcatatcgtctgcgtacaccctgctgtgtccgacacaccttaccgtccgat
tgtccggtggggtgcgtggcgtcaccatggtgtctcgctggactcagcaccttgtcaaca
aataacactacactacaagattttgtagcggaccttttgggtgatgatacgtcccttgca
tcgtcgcatcaaccgcagctgcaacggggtgaacatgggccaaatgacggtgattctcct
gcagacacctcctcagtagacgtctacaaataccctattcggagaggcatacgtgacttg
ggtaacacctgttatttgaacgctgtgctgcagatgctcttccacatccctgcagtacgg
gatgaagtgttacgggcgtctgcttcgttccctgtcgctgcccacaactctgcaaagaag
attacgccccttctggcatcaggcttaggtgagttgttcgctgagatggcgtacagtcgc
gatgagagaggtgtggatgccgaacgctttgcgactttcctttccatcgataaggggatc
cagcaggatgcccaagagttcttcgtgttactaattaactggcttcagcgagaggtagga
gatgctgtaagacacgtctttgagggcaccattttgcatgatcgagagtgcagcaagtgt
ggtcgatcgtgtaagcgagccgagcccttctccttcctttcgctcccggtgaggcagagc
atcgaggagtcgctggaggagttactccgcgtccatgaagtgcaaggttttaaatgcgag
gaatgtggtgctgtaacgagtgcattttcgcgtctgcatattcgaacgttacctgacgtt
cttgtggttcattttaaccggtttagtttcagtctgcaggagaagaggcgggaaaaaata
acacgatcagttagttttccgattgagtgggatcttacaccgtacaaagataggtggagg
caagtgcaaaagcaaacggcgagtaataatagtggtgtcgccgattctgtagtagaagcc
cgttcgaacgctgcacagctttacaggcttgtcggcgttgtcaaccatcacggtgaggct
gcagtgtgtggacactacacctaccacgggaaaatggacggccacggtggatggtatcaa
tttgataatgcagtagtgacgaggctacagcgctttcatgggacgcgggcttcgtccaaa
gaggcctatatgttagtgtacgaacggcatgcgcatccaacaaacaacccattgacttct
gctgaagaagacgttgagagggcggggtcactggacacaactatcatcttgccccctcat
ctgcaaaatcatatcgaacgcctaaatcacgaagtggagaaggtccgacaggctaggcag
ttgcagcggtcggttgtgatgaatttcctgaagcagtggaaagatgtggccgatgatatc
ttttaccgcagcgcgcgacgtaagggtcatccaatagccgttatggaggagtgtgaagat
cttacacagtacgtagcatttcccactcgatggatgaagctcttcggtcgctgtttcatt
ccctcttatattgatacaaatcgttattgtagtttcgagagaggaatgaagcgccatcgc
cggaactcgagcaaatcggcggttgaattaagtaatgagttgccggcggctggtagcgat
agcaaagaagttgaagacaatgcaccactggtggccgcggagatggttcttgacaccaca
aaaggagcgatgccaggggactgcgttctgatcaagagcatttataagtctacactaaca
gactacttggaggacgtgcgttgccctcacggaaaattagcaccatggggtcagtacaaa
cttctgtcaggagcttcggccaggagattgaatagttttctcaacagcgtaccctcgttg
ctcacttctctaactactgttggtgagtttactcccttcaaggggtggaaacttagtgag
tacatttgcgaggaatgcgtcaaacgcatgtcgaaggaggtccagcggataaagacgtca
tggaatgaggacatggagattcagaccgctgtcacccctacgtccaagtttgctgaacgt
gaagacgccgacgagttggtatacgtgagtgtggaagcggtggaacactgggaacagatg
ctaaaggtgactgaaaagtatcggtacattgtgaagcaacagggattcacgggtcttgta
gttgcgatgaaagcaagaagcgaggatgtggacaccgaagtgataccactgccgtctccg
tcgaagcttctgtgtgaacaccaacttctttcctcagttgcggcagttcgcgaggttcca
gcatctgtttggcatctcctcaagaagcgtatcttgcaactgttctatggtgacagtgtc
agcgtcaagcataccctcaccccttcagtgaaggcacatatggaaatgttacttccctac
ctccctgtcagtcgcacaggcaagtgcctggaatgcattcaaaacaaaatgaggatgatg
atggagcgccacagtgctaagatggaaaagttaaacgaaggaaagcgtttttctacgctt
gtagaggctagtcgggtgatggcacttccttctgtggaggttcgtattcgacatcccaac
acgctcgtgtggaaacgagatattaagcgctcgtatcgtcgctgttaccgcacgtgggaa
agggagcaagaggacaagatcacggcagttgaagctcgaattaagagtctgaaggaggtg
gggggacaacgggagaaaaaacagaggaccctccccacgccgcctgtaaggtgcgacaga
aagcagtcacaagaaccgtcggacagtcaacaagtctgtgaagtgacctgtgaaaactcc
caatctatccctgatgttatggaagttccctcacctttgcaatcggcctgtgacgaactc
gctgcactccgtgcagcgacacccccagatgtttccgctgtgtatggttgtatcccaaca
tggtgggtagcgcggtggtacaaatggtatacaaatgatgccgatacgggtgttggccca
ccaccttgtgtcgactattctgcgtttttttgccaacacggaggcacggtgctgccaccg
agttcactcaaccccacagacgcccattggagcaaaacatttacccttggccctattata
cgggcatggaaaagttggctgaaggatccatcggcgcttgatgtcgttgaagagagtggg
tcggtccacttccctccaatcgtgctagtaccgctaaaggagatgattgccgtgctcgaa
aggtatgggggcgagggacagctactaccggaggtaactgactcaaaggatcttgtcacc
cgcttgaacaatggcagagttgtgttgtttgtggagcgaaggggggagcgcatgcttgac
ccgccgacatgtgagatctgctcgactgctgtacttgacggggttacagagttgtctcgg
ggcttcatagatggcagtttacggttgcgtctccaccttcgccgcagtaagagacaacac
tacgatgctaatgatgtgctctctggtgttagttacaacatgactgtgggcaaactgaag
gttgaaatttctcagcgagtgcttgaatatcacggctacatcctacctgtgaatgacatg
aaattgctcctcgggcgaaagccgcttggacccaataggatctgcaaggagaacacatgt
gcaaacagcgatggaaatgctcctgatggcgcagcttccccttctgtagcatccgacgat
cgcaatgaggagtcgacaacgggagcactctccacggttgatgtggacacatgtacgttg
tttgagtgcggccttcgtgatggcgatgaagtaacagttgacgcctcgaacacaccttta
gaaaaggtgctagtaaatgacagcctctgtattcgagtgccgggggctccaacatcctcc
tcagaaacgccaactgcagaagacgttgcggcattcggagcgactcgactgtacggagtg
ctggataacgtacaaaacgggcgcgagaggaaggctccagggcagaaggcatgtgcagtt
tgcacttacctgaacgttcgcgaagcggagcgctgtgaaatgtgtgaagcggcactgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system