KEGG   Trypanosoma brucei: Tb927.8.6000Help
Entry
Tb927.8.6000      CDS       T01013                                 

Gene name
Tb08.11J15.870
Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
tbr  Trypanosoma brucei
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:tbr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Tb927.8.6000 (Tb08.11J15.870)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Tb927.8.6000 (Tb08.11J15.870)
Enzymes [BR:tbr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Tb927.8.6000 (Tb08.11J15.870)
Lipid biosynthesis proteins [BR:tbr01004]
 Desaturase
  First
   Tb927.8.6000 (Tb08.11J15.870)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 431 aa AA seqDB search
MSEAMESKVCDAPAVKKTEYDIPQWSKGNYEINWVAVAVLALPPLMGIGALMAGVPLQTN
TLIVGVLFYIFNGMIGITVGYHRLFSHRSFTAHPILQWICAFAGAGAFEGSAKWWCRNHR
IHHRYVDTFKDPYDATRGFFFSHIGWMIMKQNYAIPARVDVSDFKYNNIIQFQHRHFFKM
AIASGIILPTLVCGLGWGDWLGGYFYAAILKIVFVHHCTFFINSLAHTDLFGAVQTYSDR
HTPHDSVVCALLTFGEGYHNFHHEFSQDYRNGIKWYHYDPTKWVIRLCEFVGLASRLVRT
PNDIIKLNVNKLKYKRLLKQAAILEREMDECEPAETKMYTWEDIHSLVEKGRKLIVVSNR
VIDLDKPLNTGTSYTHDNETFQWYEVHPGGRQVLDLYIGKDATKEFGSGMHKHSAGAESL
LHHLQVGYLNE
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagcaatggaaagcaaggtctgtgacgcgccggccgtgaagaaaactgaatat
gacattccacagtggtcaaagggaaactatgaaattaactgggttgccgttgctgtgctg
gccctcccgccacttatgggcataggggccttgatggcgggtgtcccgctgcagactaac
acgcttattgtgggtgttttgttctacatatttaatggtatgatcggtattaccgtaggg
taccaccgccttttttcccacaggagttttactgcgcatcccatcctccagtggatttgt
gcttttgccggtgcgggcgctttcgaaggttcagccaagtggtggtgccgcaatcaccgc
attcatcaccggtatgttgacactttcaaggacccctatgatgcgactcgtggcttcttc
ttctcgcacattgggtggatgatcatgaagcagaattatgcaataccggccagggttgac
gttagcgatttcaagtacaacaacatcatccagtttcagcaccgacatttcttcaagatg
gccattgcgtctggcataattctcccgacgcttgtctgtggccttgggtggggtgactgg
cttggcggttacttctacgcagctatcctgaagattgtattcgtacatcactgcaccttc
ttcatcaacagtctcgctcacacggacctctttggtgccgtacaaacgtattcggaccgc
cacacaccgcacgactctgtggtttgcgctctcctcaccttcggcgaggggtatcacaac
tttcaccacgaattcagccaagattaccgcaacggtattaagtggtatcactacgatcca
acaaagtgggtcattcgactgtgtgagttcgtgggcctggcgagtcgacttgtgcgcact
ccgaacgatataattaaactgaacgtgaacaagttgaagtacaagcgactcctgaagcag
gctgccatcttggagagggaaatggacgagtgtgaaccggctgagacgaagatgtacaca
tgggaagatattcatagtttggtagagaagggaaggaaattgatagtggttagtaacagg
gttattgatctcgacaaaccactcaacactggcacaagctatactcacgacaacgaaacg
ttccaatggtatgaggttcaccctggtggaaggcaggtgcttgacctctatattggtaaa
gacgccacgaaggagtttggtagcggaatgcataagcactcggcaggtgcagagagcctt
ctccatcacctacaagtgggctacttgaatgagtga

DBGET integrated database retrieval system