KEGG   Trypanosoma brucei: Tb927.8.6390Help
Entry
Tb927.8.6390      CDS       T01013                                 

Gene name
Tb08.11J15.160
Definition
lysophospholipase
Orthology
K06128  
lysophospholipase I [EC:3.1.1.5]
Organism
tbr  Trypanosoma brucei
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:tbr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Tb927.8.6390 (Tb08.11J15.160)
Enzymes [BR:tbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Tb927.8.6390 (Tb08.11J15.160)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 280 aa AA seqDB search
MFGTPVENLTANQIKEELRTLYGVSDFSGCIEQKDLQEKLEKTRETELITHGLKYGPLLQ
IGNRQSPSGIVTLTHGLGDSANGWESVAVELSRRLPHLLFLLPTASMQPVGINGGAVMNS
WYDIRNVSSGNGVTEDAEAIIMSANYLKSLAYTASRRYQVPAGRVVYAGFSQGAVISLAA
GLTARIAPAGVAALSGYFAAAEKILPQLCNKSLPVLLCHGTMDNIIPFSAAEKTKETLES
LGVGPVTLYSYPMEHSSHPKEINDLEKFLQQVLPGPSSKS
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgtttggcacgccggttgagaatctgacggcaaatcagatcaaggaagaactgcgaact
ctatacggtgtcagcgacttctcgggatgcattgagcaaaaggatcttcaagagaaactt
gaaaaaacacgtgaaacggagctcatcacacacggactgaagtatggcccgcttctgcaa
atcggcaacagacaaagccccagtggtattgtgaccctcacacacggtttgggggactcc
gccaatggttgggagagtgttgcagtggagctttcacggcgcctcccacatcttttgttt
ttactcccaacagcatccatgcagcccgtcggtattaatggaggagcagttatgaattca
tggtatgacatcagaaatgtgagttcagggaatggagtaacggaggatgctgaggccatc
ataatgtcagccaattacctcaaaagtctcgcatacaccgcgtcacggcgctaccaagta
cctgctggtcgcgtggtgtatgccggattctcgcaaggtgctgttatctcactcgccgca
ggcctgaccgctcgcattgcaccagcaggtgtggctgccttgtcgggatatttcgctgcc
gcggagaaaatattgccgcagctgtgcaacaaaagtctaccagtgctcctctgccacggc
acgatggacaacatcatccctttcagtgcggctgagaaaactaaggaaacgttggagagc
cttggcgtgggccccgtcacgctctattcctacccaatggagcactcctctcatcccaaa
gaaattaatgaccttgagaagtttttgcagcaagtcctccccggaccttcatcgaaatcg
taa

DBGET integrated database retrieval system