KEGG   Trypanosoma brucei: Tb927.8.7100Help
Entry
Tb927.8.7100      CDS       T01013                                 

Gene name
Tb08.10K10.720
Definition
acetyl-CoA carboxylase (EC:6.4.1.2)
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
tbr  Trypanosoma brucei
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:tbr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Tb927.8.7100 (Tb08.10K10.720)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tb927.8.7100 (Tb08.10K10.720)
   00640 Propanoate metabolism
    Tb927.8.7100 (Tb08.10K10.720)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    Tb927.8.7100 (Tb08.10K10.720)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    Tb927.8.7100 (Tb08.10K10.720)
Enzymes [BR:tbr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     Tb927.8.7100 (Tb08.10K10.720)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Tb927.8.7100 (Tb08.10K10.720)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 2181 aa AA seqDB search
MSLSSPVTTMRPQLHGMKELCRFLGGKRPIERLLIANNGLAAVKGIDSVRSWLYVHTGNT
EAVEFTVMATPEDLHANAEFISLSDRHVAVPGGPNRNNYANVDIIMQTAVQNSCNAIYPG
WGHASENPALPRECVKTGERVIFLGPSAKAMFALGDKIASTIVAQSNGVPTVPWSGDEIL
LPPGVFEVDPLVYEKAYISTAEECEELCGRLGFPVMIKASEGGGGKGIRRCLRKEDVRDM
FFAVAEEVKGCHIFVMRMLENVRHLEVQLLADDYGDCIAVHTRDCSVQRRHQKIIEEGPV
FGVDASIINDMEAAAVRLAKAVKYRGLGTVEYMYDKSTQKFFFLELNPRIQVEHPVSELV
SGVNLPAALLCVGMGVPLHRIPEVRTFFGEQPYDTSPIDFTRRRCLAAKGHTIAVRVTAE
DTDEGFRPTSGRVEEIAFKNSKECWGYFSVGAGGEIHQFADSQFGHIFSSAETREEARRG
MVMALRNLVIRGEIHTSVSYVLGLLERPEFCNCDVSTDWLDRLISARILQSAQHNQQDVY
IALTAACTLRMLSKRDENHGRYVSFLSAGHVPTTEFLSNYESESYVNRSTNFNVTMGLTS
PTEISISLNGSVISVPFRKLKSGALQLRVGGKTAIAYAEKEPSSLRISIGGKETTFTGDI
DPTKLFAAVPGRFVRYLVCDGGHVEEGTIVAEVEVMKMILPLRASTVGALHHKVAPGSTI
ALGTLVAEITPDDPSKVARPREATEPWPPELLDAADKEDQMERLDSLARARRGAEALWNM
LRGYHFSGIPLDRRLKSAFSDLGALSLSSVSLTALNLPFISERVVGSDHATPNYKLRVVL
ETLISEYVEVERSFVRCNRQEAIHQVRETTGDTRKVFEIDFAHNQPSHHGVIKAVLNTLE
NNMVLLKSLMPSLSTLVNLRSTGDGTLQMQARYLLRQCSLPSFVERKIAFTRELEEGSMM
DLIQGSYGTDLLCATMFDRQVPHLIQLCLEFHVQREYFGQSRITNLDVCTRDGCWYCYYE
YEPLEEHDPLLAGVLHCHAPDATAGSAENQGAGVVLMLPDVKVLQKTWAETLNLNLQQTS
RCPSVCTVFVSVCRQFTEEEVARLCEGALRDNAEALRQHVKLERVTFIVHGVDRGPRTFT
YRSAHDWREDTLIRNVAPLSARRLELQRLENYDVVMYPTPFKEIHVFHATPKKKSVSFLE
HRIFARACVTPRDLGVAPWTVMNEIDAGHMFDICLDALDVIRSDSTIKYPKHNHLFIKMV
ELTFDLSSLRKVLSQVGKSYKWRTMHLGVAEVELSFLLPVSSGYVPFRVIVSSSSGASAA
MRIYHEWNEGGKPCLRRAQNSEDILMNSLYTSSDSVQEQAADAQKVEPPSGCPAGAVGGT
LTRALAKLEALRSLLPSRGDEGDAIDDGEECIPLQPYPLLNAKQLKRLQAWMIHTVYVHD
WPELLQYALREEWKQHARGRRFPLSRIPPSVLKATELYLDPADKKTLLEEKPQGHVPCGV
IVWLVDINPPSYYDSESNIAGSRRFVMVANDITFQSGSFAVPEDDVFSAASVLARQLRIP
FVYISANSGARIGLSAEVKKRFRVAFNDAEEAEYLYLVQSDYDELVSRGVRLAVEKLEPR
QVEGDEGGEVRYVIRGVVGGTEEYLGVENLRGSGLIAGHMSKNYSNVPTISIVTGRSVGI
GAYLNRIGRRVIQTGDAPLILTGAAALNRLLGKEVYSDNSQLGGRQVMVPNGVTHWYAKN
NRLAAETLLRWLDYVPPVVHPLRCSPRILALRQPDPIDRDVTYEPSGVESYDPRGLVRGV
GDKLGLFDRDSWVESLEGWAKTVVTGRATLGGIPCGIVLVETRPTRKCKPADPADPTSSE
AFVAQAGQVWFPDSARKTADALDDFHRERLPCFIFANWRGFSGGMRDMFEEVLKFGASIV
DNLRVYNCPVFIYIPPRGELRGGAWVVVDPSINHCGAVEMYCDGSARGGVLEAAGIAEIK
FREADVRELIRRNEPRLRSLSPDHRHAEENRLLPRYNDVALRFADLHDTHVRMEATGVVR
GVIPWKDSRRRFYEKLQRKLKELSLAATLVERRMAGDLADGVRYLEQAFAQKHPGVLWGS
DDALQLQWLIEYESELNVSTHNIVSPTSASAEILEALRRHVPLHGEQNEAGEGLEGCFEE
LFKDERMRRAAMQALERTTAK
NT seq 6546 nt NT seq  +upstreamnt  +downstreamnt
atgtctctcagtagtccggtaacgaccatgcgcccacagctgcatggtatgaaggaactt
tgcaggttccttggtgggaagaggccaattgagagattgcttatcgctaacaacggattg
gctgcagtaaagggaatcgactctgttcgctcctggttatacgtgcacactggcaataca
gaggcggtggagtttactgtgatggcgacgccggaggaccttcacgcgaatgcagagttt
atttctctctcagacagacacgttgcagtccctggaggccccaacagaaacaactacgcc
aacgttgacatcattatgcagacagccgtacagaactcctgcaatgccatctacccgggc
tggggtcatgcctcggagaatccggcgttgccccgcgaatgtgtgaaaactggtgagagg
gttatatttctcggcccctctgcaaaagcgatgtttgctttgggcgacaaaattgcgtcg
accattgtggcgcagtcgaacggcgtgccaacagtgccctggagtggtgatgagatccta
ttaccaccgggtgtgtttgaggtggatccgttggtgtatgaaaaagcgtatataagtact
gcagaggaatgtgaagaactgtgtggccgccttggtttccctgtcatgattaaagcctcg
gagggcggtggtggcaaaggtattcgccgctgtctccgcaaggaggatgtgcgggacatg
ttttttgccgtcgcagaagaggtaaagggctgccatattttcgtcatgcgtatgttagag
aacgtgcggcatctcgaagttcagttgctggcagatgactacggcgactgtattgccgtg
cacacacgtgactgctcggtgcagcgacgacaccaaaagatcattgaggaggggcctgtg
tttggtgtggatgcctcaattatcaacgacatggaggcagcagccgtgcgtctcgccaag
gctgtaaaataccgcggtcttggtacggtggagtacatgtacgacaaatccacgcagaag
tttttcttcttggagctcaacccgcgtatacaggttgaacaccccgtttcagagcttgtg
tctggtgtgaaccttccggctgcgctgctgtgtgttggcatgggagttccgcttcacaga
atcccggaggtacgaactttcttcggagagcaaccgtacgatacctcgccgatagatttc
acccggcgccgctgtcttgcggcgaaaggtcacaccatcgccgtacgcgttacggcagag
gacacagatgaaggcttccgtccaacgtcgggccgtgtggaagagattgctttcaaaaac
agcaaggaatgctggggttatttttccgttggtgcgggtggggagatacaccagtttgca
gattcacaatttggacacattttttcttctgcggaaacgcgtgaggaagcgcgacgtggg
atggtgatggccctgcgtaaccttgttattcgtggtgaaatacatacgtccgtgtcatac
gtcttggggcttcttgagaggcccgaattttgcaactgtgacgtcagtacggattggcta
gaccgccttatatccgcgcgaattctgcagagtgcgcagcataaccagcaagatgtatac
atcgctcttactgcagcgtgcacactgcggatgctatcgaagcgagatgaaaaccacggc
aggtacgtttcatttctcagtgcggggcacgttcccacaactgaattcttgagcaactac
gaatcggagtcgtacgtcaatagatccacaaactttaacgtcaccatgggtctaacaagc
ccaaccgagatatctatttctcttaacggcagtgtgatctctgttccgtttcgtaagttg
aagtctggtgcgctgcagctccgtgtgggaggaaaaacagcaattgcgtacgcagagaaa
gaaccatcaagtctgcgcatttctattggtggaaaggaaacaacattcacaggtgacatt
gatccgactaagttgtttgctgcggttcccggtcggtttgttcggtaccttgtgtgtgat
gggggtcatgtggaagaaggaactattgtggcagaggtggaagtgatgaagatgattttg
ccactgagggcgtcaacagtgggtgcgctgcaccacaaagtagcccctggtagcaccatt
gccttgggtacgctggttgcggaaataaccccggacgacccaagtaaggttgcacgaccg
agggaagcgacagagccgtggccgccagaactgcttgatgctgcagataaggaagaccag
atggagcgcctcgacagcttagcccgagcgcggcgtggagcagaggcgttgtggaatatg
ttacgtgggtatcactttagcggtatcccactggaccgacggcttaagtcggctttctca
gaccttggagcgctcagcctttcctcagtgtcgctcactgcgcttaacttaccatttatt
tcggagagggttgtcggttctgaccacgcaacgccgaactataaactccgcgtcgttttg
gagacgctcatttccgagtatgtggaggtcgagcgctcatttgtgaggtgcaaccggcag
gaagctattcatcaagtgcgtgaaactacaggagatacgcggaaggtatttgagattgac
tttgctcataatcagccctctcaccacggtgtcattaaggccgtgctgaataccttggag
aacaatatggtactgttaaagtctctcatgccctcactttccaccctggtaaatttgcgc
tccactggcgatgggacacttcagatgcaagctcgttacttactccgacagtgcagtctt
ccttccttcgtggagcgcaagatcgccttcacaagggaactagaggagggttccatgatg
gacctcatccagggaagctatggtactgatttgctttgcgctactatgtttgaccggcag
gtgccacaccttatacagttgtgcctcgagttccatgtgcagcgtgagtactttggtcag
agtcggatcacgaaccttgacgtctgtacgagggatggatgctggtattgctattatgaa
tatgaaccactcgaagagcatgacccgctgctggctggtgtacttcactgccacgccccg
gatgcaacggccggtagtgctgagaaccagggtgccggtgttgttctgatgcttcccgac
gtgaaggtgcttcagaaaacgtgggcggagacgctcaacttaaacttgcagcagacgtct
cggtgcccttctgtgtgcacagtctttgtttcggtctgcaggcaatttacggaagaggag
gtcgcgcgtttgtgcgagggtgcgctgagggacaatgcggaagcactcaggcagcatgtg
aagctggagcgcgtcacatttattgtgcatggtgttgaccgtggcccccgtacattcact
tatcgtagtgcccatgactggcgcgaggacacactgatccgaaacgtggcaccgctctcc
gcacgccggttagagctgcaacgtcttgaaaactatgatgtggttatgtacccgacaccc
ttcaaggagattcacgtgttccacgccacacccaaaaagaaaagtgtttcatttcttgag
caccgcatctttgcgcgcgcatgcgtgactccccgcgacttgggtgttgcaccatggaca
gtgatgaatgaaattgacgcagggcatatgtttgacatatgcctcgatgcacttgatgtc
atacgtagtgacagcactatcaagtacccgaagcacaatcatcttttcataaaaatggtt
gaactaacttttgacctgagcagcttgagaaaggtgttgtcgcaggtgggaaaatcgtac
aagtggcggacgatgcatcttggtgtggccgaagtggagctgtccttccttcttcccgtt
tccagtggatacgttccgttccgtgtcatcgtgtcatcttcttcgggggccagcgcggct
atgcgcatctaccacgagtggaatgagggtggaaagccatgcctacgtcgagcgcagaac
tctgaggacattctcatgaactctctttacacgtcgtctgacagcgtgcaggaacaggca
gctgacgcgcaaaaggtagagcccccttcagggtgccctgccggcgccgtcgggggtact
ttaactcgtgccctggcaaaactagaagcgctgcggagcctgcttccttcacggggtgat
gaaggagacgcgattgatgacggtgaagagtgcattccattacaaccgtacccattgttg
aatgcaaagcagcttaaacggctacaagcctggatgatccacacggtgtacgtgcacgat
tggccagaacttcttcagtatgctttgcgtgaagaatggaagcagcatgcacgtggccgc
agatttccgctctcgcgtattcccccttctgttcttaaggccacagaactctatctcgat
ccagcggacaagaagacccttcttgaagaaaaaccacagggtcacgttccatgtggagtc
atcgtgtggttggttgacataaacccgccttcatattatgacagtgaatctaacattgcg
ggaagccgtcggtttgtgatggttgccaatgacattacttttcagtcgggttcctttgct
gtgccagaggacgatgtcttctccgcggcctctgttttagcccggcagttgcgcatcccg
tttgtgtatattagtgcaaacagtggtgcgcgtatcggcctaagcgccgaggtgaagaaa
aggttccgtgttgcctttaacgatgcggaggaagcggagtatttatacctcgtgcaatct
gattacgatgaactggtgagccgtggcgtgcggcttgcggtggagaagttggaaccacga
caagtggaaggtgacgaggggggcgaagtgaggtatgtcatacgtggtgtcgttggtggg
acagaggagtacttgggtgtcgaaaaccttcgtgggtcggggctcattgctggccacatg
tcaaagaactacagcaatgtaccgacgatcagcattgtgaccggcagaagtgttggaatt
ggcgcgtacctcaaccgtatcggacgtcgagttattcagaccggtgatgcccccctcata
ttgacaggcgcggctgcactcaacagacttctcggaaaggaggtgtacagtgacaacagt
caacttggcgggcggcaagtgatggttcctaacggtgtaacacactggtatgcgaagaac
aaccgcctggcagctgagacactcctgcgctggctcgattatgtcccacccgtcgtacat
ccactgcgttgttctccacgtatccttgcgctgcgacagccagatcctattgaccgagac
gtgacttatgaacccagtggtgtggagtcttacgacccacgggggttggtccgaggtgtg
ggtgacaaattggggctgttcgatcgcgattcctgggttgagtcactggaaggttgggcc
aagaccgttgttacgggccgagcaacacttggtggtattccatgcggtattgttctcgtc
gaaacgcggccaacgcgcaaatgcaaaccagcagaccccgcggacccaacgtcgtcagag
gcctttgtcgcacaggcagggcaggtttggttcccggattcagcacgaaagacggcggac
gcgctggacgacttccaccgggagcggctgccatgtttcatcttcgcgaactggcgaggt
ttttcaggtggcatgcgggacatgtttgaagaggtgctaaagtttggcgcctccatcgtt
gacaacctccgcgtgtacaactgcccggtatttatttacatcccaccgcgcggtgagcta
cgcggtggagcttgggttgttgtcgatccatccatcaaccactgtggtgcagtggagatg
tactgtgatggtagtgcccgtggcggggtactcgaagctgcaggtattgcagagatcaag
ttccgtgaggctgacgtacgggagctgatccgacgaaacgaaccgcggttgaggtcatta
agccctgaccaccgccatgcggaagagaatcggctgctaccgcgttacaacgacgtggcg
cttcgatttgcggaccttcatgacacacatgtccgcatggaagcgactggcgtcgtgcgt
ggggtcattccctggaaggacagtcgacgtcgcttctacgaaaagctccagaggaaactg
aaggaattgtcacttgcggcgacgctggtggagcgtcggatggcaggtgacctcgcggac
ggtgtacggtacctcgagcaagccttcgcacaaaagcacccaggagttttgtggggaagt
gatgatgccctgcagttgcagtggctgatagagtatgaaagcgagctcaacgtttccaca
cacaacattgtgtcacccacttcagcatccgcagaaatactggaagcgctccggcgtcat
gtgcccttacatggagaacaaaacgaagcaggtgaagggttggaagggtgttttgaggag
cttttcaaagacgaaaggatgcggcgtgcggccatgcaggcgctggaacgtacaaccgcg
aagtaa

DBGET integrated database retrieval system