KEGG   Tribolium castaneum (red flour beetle): 100141713Help
Entry
100141713         CDS       T01046                                 

Definition
asparagine synthetase [glutamine-hydrolyzing]
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100141713
Enzymes [BR:tca01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     100141713
Peptidases [BR:tca01002]
 Cysteine Peptidases
  Family C44
   100141713
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG5
AA seq 562 aa AA seqDB search
MCGIWALFHPQNGNVLLKDCTENVMKIRHRGPDASRVETDKRVTNCCVAFHRLAIVDCIY
GMQPMRLHQFPLTLLICNGELYNCKELEKQQGFKYETYCDVECITHLYHKLGIEGCVKHL
DGVYAFCLIDMEKQKVFLGRDPYGVRPLFKLTTSDGTLGICSEAKGLIGLAREENGEKKT
IKPFTPGTFEEYDLMKTGGVKLVRKQTFHHPGDKPTFQPFVLYEELTHDPLENIRKLLTT
AVKKRLMANRRIGCFLSGGLDSSLIASLLVRAAKEVDLPYKIQTFCIGMGDSPDVIAAKE
VADFIGTEHHVITFSEEDVARVLDDVIYTLETPDITTIRASIPMYLISRYVLENTDTTVL
FSGEGADELCQGYIYFRDAPSAQAGHDDSIRLLKEIYLFDGLRGDRTTAASSLELRLPFL
DLQFTHYYLSLDPKLRQPKDGVEKFLIRSAFDKTGVLPDRILWRHKEAFSDGVASKKKSL
FQFLQEIVDKRMPEPFDLEAAKKKYPHCTPNSKESLYYREVFEKSFPNAAEKFIPFYWMP
RWVEGVTDPSARFIKHYAAPQK
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatttgggctttatttcaccctcaaaatggcaatgtcctgctcaaggattgt
acagagaacgttatgaaaataagacatcgggggcccgacgcttcacgtgtcgagacggac
aagcgggtcactaactgttgtgtggcattccaccgcttggcaatagtcgattgcatttac
ggaatgcaaccgatgcgccttcaccaatttcccctaactctcctaatatgcaatggcgag
ttatacaactgcaaagaattggagaaacaacaaggcttcaaatatgagacttattgcgac
gttgaatgcatcacccatctgtaccacaagcttggtattgaagggtgcgtcaaacacttg
gatggcgtttacgccttctgtctcatagacatggaaaagcagaaagttttcctggggaga
gacccgtacggcgtacgccctttattcaagctcacgacttcggacggaacgttgggcatt
tgctccgaagccaaaggtttgattggtttagcgagagaagaaaacggggaaaagaaaaca
atcaagcctttcacacccggaactttcgaagaatacgacttgatgaaaaccgggggagtt
aagctagtccggaaacaaaccttccaccaccctggcgacaaaccaaccttccaaccgttc
gttttatacgaagaactaacgcacgacccgttggaaaacataaggaaattgctaacaacg
gccgttaagaagcggttaatggcaaaccggcggattggctgtttcttatccggagggcta
gactcatcccttattgcctctctgctggtcagagcggccaaagaagtagaccttccatac
aaaattcaaacgttttgcattggtatgggcgacagccctgatgtgatcgcggcaaaagaa
gtggccgactttatcggcacggagcaccacgtgatcactttcagcgaagaggacgtagct
cgggtccttgatgacgttatctacactctcgaaacgcccgacattaccacaatcagggcc
tcaatccccatgtatttgatttcgcgctatgtattggaaaacaccgatactacagttctc
ttcagtggagagggcgctgatgagctttgtcaaggatacatctatttcagagacgctcca
agcgcgcaagcaggccatgacgacagcatccgtctccttaaagaaatctaccttttcgac
ggcttaaggggcgatagaaccacagctgcgagcagtcttgagctgcgattgcctttcctt
gacttgcagtttacgcattattatctcagtcttgacccgaaattgcggcagccgaaagat
ggcgttgagaagtttttgataagatcggcgtttgataagacgggggtgttgccagatcgg
attttgtggaggcataaggaggcgttcagtgacggggtggcgtccaagaagaagtcgctg
tttcaattcctccaagagattgttgataagaggatgcctgaaccgtttgatttggaagct
gcgaaaaaaaagtacccacattgtactcccaacagtaaagagtcgctttattatcgcgaa
gttttcgaaaagagttttccgaatgcggcggagaagtttattcccttctattggatgccg
agatgggttgaaggtgtcacagatccttcagcacggtttatcaaacattatgcggctccg
caaaagtaa

DBGET integrated database retrieval system