KEGG   Tribolium castaneum (red flour beetle): 100141788Help
Entry
100141788         CDS       T01046                                 

Definition
protein phosphatase 1, catalytic subunit, alpha-like
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:tca03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG6
AA seq 327 aa AA seqDB search
MAEADKLNIDSIIARLLEVRGARPGKNVQLTESEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDQMGWGENDRGVSFTFGAEVVGKFLHKHD
FDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
KRKFQYNMNAGRPVTPPRGGTNKNKKK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagccgacaaattaaatatcgatagtatcatagctcggctattggaagtacgc
ggagcaagacctggcaaaaatgtacaattaaccgaaagcgaaatccgggggctgtgcctc
aagtcccgggagattttcctctcgcagccgattttactggaactggaggcgccacttaag
atttgcggtgatatccacggtcaatattatgatctccttcgtctgttcgaatacgggggg
tttcccccagagtcgaattacctattccttggcgattacgtcgatcgtgggaaacaatca
ttggaaaccatctgtcttttgctcgcctacaaaataaaatatcccgagaatttcttcctt
cttagaggtaaccacgagtgcgcctcaatcaaccgcatatacggattctacgacgaatgt
aaaaggaggtacaatataaagttatggaaaaccttcaccgactgcttcaactgcttgccg
gtggcggcgatcgtcgacgagaagattttctgttgtcatggtggcctcagtcccgacctc
cagtcgatggaacaaatccgaaggataatgcgaccaacagacgtgcccgaccaaggcctt
ctctgtgacctgttgtggtcagatcctgacaaagatcaaatgggctggggtgaaaatgat
cgtggtgttagttttactttcggcgccgaagttgtgggaaaattcctccataaacacgac
tttgatctgatttgtcgagcccatcaagtcgttgaggacgggtacgaatttttcgccaaa
cggcaacttgtcacgctttttagcgccccaaattattgcggcgagtttgataacgcggga
gcgatgatgtcagtggacgaaacgttgatgtgcagttttcaaatcctgaagccggccgac
aagcggaagtttcagtataacatgaacgccggaaggccggtgacgccacctagaggaggc
actaataaaaacaagaagaagtga

DBGET integrated database retrieval system