KEGG   Tribolium castaneum (red flour beetle): 100142469Help
Entry
100142469         CDS       T01046                                 

Definition
(RefSeq) 4-aminobutyrate aminotransferase, mitochondrial-like
  KO
K13524  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100142469
   00650 Butanoate metabolism
    100142469
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100142469
   00280 Valine, leucine and isoleucine degradation
    100142469
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100142469
Enzymes [BR:tca01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     100142469
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     100142469
Amino acid related enzymes [BR:tca01007]
 Aminotransferase (transaminase)
  Class III
   100142469
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
LG9
AA seq 491 aa AA seqDB search
MLFRRFKNCIKLNKYQTRTCCSSVEEPKGPSVKTPIPGPNSKKLQGELHKIHYSETIQLF
INYVKSIGNYLVDADGNVILDTYTQISAAPLGYNHPELLKVFKNDDNLKRLINRPALGLF
PGDDYPERVKNVFSQIAPCLPKIYLMMCGACANENAFKHMFVSYQLKKRGGRPFTEEEKT
SAVLNKPPGCPNLTILSFHNAFLGRTFACLAATHSKFIQKVDLPSIDWPAAHFPIYKYPL
EENMRENKEEDRKCLAEVEDLMAKYEKKGTPVAGVVVEPLQSEAGNYEASPKFFQQLQKI
VKKNNAYLLFDEVQTGGGASGKFWFHEHFDLETPPDVITFAKKFQLGGYFHSEELTPDVP
YRIFNTWMGDPGKLMLLEVIIKVMREQNLLETVQKAGKRLKCGLHQFESEFPNLVYSVRG
VGTLLAFDAKDENMRNEFMKKLLNKGVLVGNCGYKGIRFRPALTFDESHVDIFLDKFREV
LKEINNDCVRL
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgttattcagacgttttaaaaactgcataaaactgaacaagtatcaaactcgtacatgt
tgttcttcggtagaagaacccaaaggcccttctgtcaaaacgccaatacctggccccaat
tccaaaaaactccaaggagagttgcacaaaatacattattcagaaacaatccagctgttt
attaattacgtaaaatcaattggaaattatttggtcgacgccgacggcaatgttatcttg
gacacctacacccaaatatccgcagcccccttaggctacaaccaccccgaattactcaaa
gtgttcaaaaacgacgacaatcttaaacgtttaattaacagacccgctcttgggttattc
cccggagacgattatcccgaaagagtgaaaaatgtgttcagtcaaattgcgccctgtttg
cccaaaatctacctcatgatgtgcggggcgtgtgccaacgaaaacgccttcaaacacatg
tttgtgagctaccagctcaaaaaacgaggcggccgcccctttaccgaagaagagaaaact
tccgccgtgcttaacaaacccccaggttgtcccaacttaacaatactgtcgttccacaac
gcttttctcggccggacttttgcctgtttggccgcaacgcactcgaaatttatccaaaag
gttgacctcccgtccatcgattggcccgctgcgcattttccaatatacaagtatccttta
gaggaaaatatgcgggaaaataaggaagaagacaggaaatgtttggccgaagttgaggac
ttgatggcgaagtatgagaagaaaggaacaccggttgctggagtagtcgtcgagccttta
caatcagaagcggggaattacgaagcatccccgaaatttttccaacaattacaaaaaatc
gtgaagaagaacaacgcgtatttgttgttcgatgaagtgcaaacggggggcggagcctcg
gggaagttttggtttcacgaacattttgacctagagacgccgcccgatgtaatcactttt
gcgaaaaaatttcaacttgggggttacttccattcggaggagttgacgccggatgtgcct
tatcgtattttcaacacctggatgggagatccggggaaacttatgttacttgaagtgatt
attaaagtcatgagggagcaaaatcttttagagactgtacaaaaagccggaaaaagactc
aagtgtggtctccaccagttcgaaagtgaatttcctaatttagtgtattcagtacgaggg
gttggaactcttcttgccttcgatgccaaagatgaaaacatgagaaatgaatttatgaag
aaactgctaaataaaggtgtcctggttgggaattgtggttacaaaggcattaggtttcgg
cccgctttaactttcgacgaaagccacgtcgatatatttttagacaagttcagagaagta
ttgaaagaaattaataatgattgtgtacgtttgtaa

DBGET integrated database retrieval system