KEGG   Tribolium castaneum (red flour beetle): 100142526Help
Entry
100142526         CDS       T01046                                 

Definition
ADP-ribosyltransferase 5-like
Orthology
K00775  
NAD(P)-arginine ADP-ribosyltransferase [EC:2.4.2.31]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Enzymes [BR:tca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100142526
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG3
AA seq 270 aa AA seqDB search
MIPMQYLFFLFLVSSVVTTEMSKKGAFDHLKRFVGTEAPIILPSVFDTPDSADDFPIAQI
ALNLSLEKIRLYLNRELAQNPTYYAVWQEATKIFEEDVATGKYEIIAPNEFYQAIISYTY
VNGSLYVYSDFNAKSRQLTDIDSWNRFPYKSLYSLLAQSVNYVISMPNAIRDKIQIYRGL
DFHFPCEVNQVVNFVQFSSFSCSKEIAEEFSGNGTVFQLRPPMKFGTAIGIQEYSVFYEQ
EEVLVMPWSVFVVKEVAQVDNRLEVVLENV
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgattcccatgcagtatctcttcttcttattcctcgtgtcgagtgtagtgaccacagaa
atgtccaaaaaaggggcatttgaccatttgaagcgtttcgtcggaacggaagctccaatc
attcttccatcagttttcgacactcctgacagtgctgacgacttccccattgcccaaatc
gccctcaacttaagtttggaaaaaatcagattgtatttgaaccgagaactggcccaaaac
cccacatattatgccgtctggcaggaagccacaaaaatcttcgaagaagatgtcgccacc
ggaaaatacgaaatcattgctcccaacgagttttatcaagcaattatctcgtacacttac
gtgaacggatcgctctacgtgtattctgatttcaatgccaagtcgaggcaattaactgat
atcgattcctggaaccgatttccgtacaagagtctctacagtttgctggcacagtcggtc
aactatgtgataagcatgcccaacgctatcagggacaagatacagatctacagaggactg
gattttcattttccgtgtgaagtgaaccaagtcgttaatttcgtgcagttttcctcgttt
agttgctcgaaggaaattgcagaggagttttccgggaacgggactgttttccagctgagg
ccacccatgaaattcgggactgcgattggcattcaggagtattcggttttttacgaacag
gaagaggttttggtgatgccatggagtgtgtttgttgttaaagaggtggcgcaagtcgat
aatcggttggaagtggttttggaaaatgtctag

DBGET integrated database retrieval system