KEGG   Tribolium castaneum (red flour beetle): 100187738Help
Entry
100187738         CDS       T01046                                 

Gene name
Gemin7
Definition
gem (nuclear organelle) associated protein 7
Orthology
K13135  
gem associated protein 7
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:tca03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 101 aa AA seqDB search
MAQDKVPGAPDCDTVKQEAMAFLRERYLYLLSSLCGAGDCEIKMHENTDVKCRIKAFDSN
FENIIVEDLQTPMPVPINKAILRTGDIISMKFHCDYTKLIK
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atggcccaagacaaggttccaggcgccccagactgcgataccgtaaagcaggaagcgatg
gcgtttttgcgggaacggtacttatacctgctttcaagtttatgcggggccggagattgt
gaaataaaaatgcacgagaacacggatgtgaaatgccggataaaagcctttgattcgaat
tttgaaaatattattgttgaagatttgcaaacaccgatgcccgtgcccatcaataaggcg
attttgaggaccggtgatataatttcaatgaaatttcactgtgattatactaaattaatt
aaataa

DBGET integrated database retrieval system