KEGG   Tribolium castaneum (red flour beetle): 103312484Help
Entry
103312484         CDS       T01046                                 

Definition
(RefSeq) protein ABHD12B
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Enzymes [BR:tca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     103312484
Peptidases [BR:tca01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   103312484
Exosome [BR:tca04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   103312484
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
LG3
AA seq 255 aa AA seqDB search
MNRAKEVIYVRRPLSRAAKRRLKYVGIFLLVFALLLVLFVFIGFPLIFMNSIALQRLLMF
TNWNLPSKSSHFEKFELLAGLRNFYVSVNDLNSKKIISLGVWHLLPYIYEPDVITDSEFD
FESVLKSGNSSVLFYFHGTGEDRSSAFEKYKQFRGFFHVITFDYRSYADSTKAELSEDAV
VNDCVQLYERLLTRTNASIIFWGHSLGSALATRTLAIIQAKHVRQPIGLVLEAAFTKMSE
ELYVHPYDFRLVAVF
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgcgctaaagaagttatttacgtaagaagaccactgagccgagcagctaagcga
agacttaaatatgtaggaatttttttacttgtgtttgcgctcttgctcgttttgtttgta
tttatcggatttccgctgatttttatgaattccattgccctgcagaggcttctcatgttc
accaattggaatttaccgagcaaaagcagtcattttgaaaaattcgaattattggccggt
ttgcggaacttttacgtctccgtgaacgacttgaacagtaaaaaaataatctcgctggga
gtctggcatttattaccttacatatacgaaccggacgtaataacagactccgaatttgat
ttcgagtcggttttaaaatccggcaattcaagtgttttattttatttccatggaacgggg
gaagaccggtcgtcggcctttgaaaagtacaaacaattccgtgggttcttccacgtgatc
acgtttgattacagaagctatgctgactcgactaaggccgagttgtctgaagatgcggtc
gtgaacgactgtgtccagttgtacgagaggcttttgaccaggaccaacgcctcgatcatt
ttttggggacactctttaggctcagcccttgcgaccagaactctggccattatacaagcg
aaacatgtcagacaaccaattggtttggtcctggaagccgcctttaccaaaatgagcgag
gagctgtatgtacacccttacgattttcgcctggttgccgtattttga

DBGET integrated database retrieval system