KEGG   Tribolium castaneum (red flour beetle): 654991Help
Entry
654991            CDS       T01046                                 

Definition
uncharacterized LOC654991
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Glycerophospholipid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    654991
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    654991
Enzymes [BR:tca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     654991
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG5
AA seq 1109 aa AA seqDB search
MSASYNLKICSFFVILAVARGGLNPVVLIPGDGGSQVEAKLNKSASVHYICEKTTSDFFN
IWLNMELLVPLVIDCWIDNIKLIYDNATRTTRNNDGVEIRIPGFGGTETVEWLDPSHASA
GAYFNSIAKTLVSLGHERNKTMKGAPYDFRKAPNENQQFFTDLKALIEQTYTENNNQPVI
IIAHSMGGPMSLFFLNQQTQDWKDKYIRSLVTLSGAWGGSMKAVKVYAIGDDLGSYVLRE
SVMREEQITSPSLAWLLPSKLFWKPDEVLVQTSRKNFSLNNLEEFFQAINFPNGWEMRKD
TEKYQLDYRPPGVEVHCLYGVGVDTVERLFYKPGTWLDGYPTLINGDGDGTVNRRSLEGC
LHWESLQKQKVYSKQLPKVDHMQILNNKDVLSYIANLINDVXFRNYRNFNAVTSLLFLIL
SLVRRMVLVVGERPPQDRLKIQIVGDLREEAVDAGHVTALLEHLLTALHHQGRRHVKGHQ
GRSRQEEVVQPHHVLVLVERVPEPGQEPRQGEHRPDRCPEMVGAEALHDAEAQGFAHHQQ
KRDGDVMVALVVPQMGVLDDHPQYQDSELVLQRQPLLVWNARGEPLEGAVHVQDNLLVLT
MTGQLLQNSSNSGHTLHRKSSPTSPNSSIASSWYVFNVELLLLRASSIKARFLRSASVSR
SVMRGGPVKMSKSQRDHLMHSTGTTPYEIIGVILPSLFYTTITTIIVTLLQTRPKNLPLQ
FTIEFLTLVLPIILNVTVLSDYTFELLSTFLIITLSLILWLRGSKPLSAKPPQAPLTHDY
ITNSRSTINIISVIAILAVDFLIFPRRFAKTKTYGYSLMDVGVGLFIFSNGIVDAGRTDL
GRSLKGAVPLLVLGVGRFFGTKLLGYHVPVTEYGVHWNFFISLAVIKIVVSLVFSVIEVK
YIFINATLLLLSHESLLQGGLKNFVMDDHKRSNFLTANREGIISCFGYVSLYMFSANFSY
FVGLKKGGEGVKKTVIKFVFLATLMLFLSQIWQKYCGISRKLANSAYCFWVLFIGIFMTG
LYYIFAKILEDTFRNKLHVNLQLPLIFQAINYNGLVFFLVSNLLTGLVNVLCDTLQVSSV
VSLGIITVYMLVNCAIVCVLFTKQIKLKL
NT seq 3330 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcctcatataacctcaaaatctgtagttttttcgtaattttggcggtagccaga
ggcggtttaaaccccgttgtgttaatcccaggcgatgggggctctcaagtcgaagccaaa
ctcaacaaatcagcctcagtgcattacatttgtgaaaagacaacgtcggattttttcaac
atatggctcaacatggagctgctggtgcccctagtcatcgactgctggattgacaatatt
aaactgatctatgataacgccactcgaacaacgcgcaataacgacggggtcgagatcagg
atccccggctttgggggcaccgagactgtggagtggctggaccccagccatgcctctgca
ggtgcgtatttcaacagcattgccaagaccttggtcagtctcggccacgagcgcaacaaa
accatgaaaggggcaccttacgacttccgcaaagcgcccaacgaaaaccaacagtttttt
accgatctcaaggccctaattgaacaaacgtacacggaaaataacaatcagccggtcatt
atcattgcacattcgatggggggccccatgtctttgtttttcctgaaccagcaaacgcaa
gactggaaagacaagtacatcaggtctttggttacgctaagtggggcctgggggggctcc
atgaaagcggtcaaagtctacgcgattggggacgatttggggtcgtacgttttgcgggag
agcgtcatgcgggaggagcagatcacctcccccagcctggcgtggctcctcccctccaag
ctcttctggaagccggacgaagtcttggtgcaaaccagtcggaaaaatttcagtttgaat
aacctggaggagtttttccaagcgattaatttccccaacgggtgggaaatgcgcaaagac
actgagaagtatcagctggattaccggccgccaggggttgaggtgcactgcttgtacggg
gtcggggttgatacggttgaacggttgttttacaagccagggacgtggttggatgggtac
cccactttgatcaatggggacggggacgggactgtgaaccggaggtcgcttgaagggtgt
ctccactgggagagcctccagaaacaaaaagtctactcgaagcagcttcccaaagtcgat
catatgcaaattctcaacaataaggacgttctgagctacattgccaatctcattaacgac
gtgtgatttagaaattaccgaaattttaacgctgttacttcccttctcttcctgattttg
agtcttgtgcggaggatggttcttgtagtaggtgagcgcccgcctcaagatcgcctcaaa
atccaaattgtcggggatttgcgagaggaggcagtggatgctggccatgtcacagccctg
ctcgaacacctcctcacggcgctccaccaccagggccgccgccacgtaaaggggcatcag
gggcggagtcgccaagaagaagtcgtacagccgcaccacgtccttgtactggttgagcga
gtgcccgaaccaggtcaggaaccacggcagggcgaacatcgtcccgaccgttgccctgaa
atggtcggtgctgaggcgctccatgatgctgaagcccagggcttcgcccaccaccagcaa
aaacgtgatggcgacgtcatggtagccctggtagtaccgcagatgggggtacttgatgat
caccctcaatatcaagacagtgagctggtcttgcaacgccagccgctgcttgtatggaat
gccaggggggaaccgcttgagggagcggttcacgtccaggacaacttgctcgtactcact
atgactggacagctcctccaaaattcgagcaacagcggccacactttgcaccgcaagtcg
tcgccgactagcccaaactcgtcaattgccagctcttggtacgttttcaacgtcgaatta
ttgttactcagagcttcctcaatcaaggcgcgttttttgcgttccgcgtccgtttccaga
tctgtgatgaggggaggaccggtcaagatgtccaagtcccaaagggaccacctgatgcat
tccacggggaccaccccctacgaaataatcggcgtaatcctcccgagccttttctacacc
accatcaccacaataatcgtgaccctgctccaaacccgccccaaaaacctccccctccaa
ttcaccatagaattcctcactctagtcctccccattattttaaacgtgacagtattatcg
gactacactttcgaactcctctccacatttctcatcatcaccctatcgctgattttgtgg
ctgcggggctccaagcccctctccgccaaaccaccacaagcccccctaacccacgactac
atcactaacagccgctccaccatcaacataatttcagtgattgcgattctggccgttgat
tttttaattttcccgcgccggtttgccaaaaccaagacgtacgggtacagtctcatggat
gtgggcgtggggctgttcattttctccaacgggatcgtggatgcgggccggaccgacctg
gggaggtcgctcaagggggctgtaccgctattggtactgggcgtggggcgcttttttgga
acaaaactgctgggttatcacgtcccggtgactgaatatggggtccactggaattttttc
atatcgctggcggtgatcaaaatcgtagtttcgctcgtttttagcgtgattgaagtcaaa
tatatttttatcaatgcgactttgttgttgctatcgcacgagtctttgctacagggtggc
ttgaaaaatttcgttatggatgatcacaaacgtagcaattttttgaccgctaatagagag
gggatcatctcgtgttttgggtacgtctccttgtacatgttttcggccaattttagttac
ttcgtcggtttgaaaaaagggggggaaggggttaagaaaaccgtgatcaagtttgttttt
ttggccactttgatgctgtttttgtcacaaatctggcaaaagtattgtgggatttcccgg
aaattggcaaactcggcctactgtttttgggttctttttattgggattttcatgactgga
ctttactatatttttgcgaaaattttagaagatactttcaggaataagctacatgtcaac
ctccaactaccgctcatttttcaagctattaactacaacggtttagtttttttcctggtc
agtaatttattaaccggcctagtcaacgttttatgtgatacacttcaagtttcgtctgtt
gttagtttaggaattattaccgtttatatgttggtcaactgcgcaattgtatgtgtcctt
tttacaaaacaaatcaaattaaaactctaa

DBGET integrated database retrieval system