KEGG   Tribolium castaneum (red flour beetle): 655219Help
Entry
655219            CDS       T01046                                 

Definition
CG4165 CG4165-PA-like
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Enzymes [BR:tca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     655219
Peptidases [BR:tca01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   655219
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG8
AA seq 849 aa AA seqDB search
MVCKKKHQGDPTGGESTESCDENDNMTDCRHVRQAVDLQKVKKALIKTGLTTECEQCKKM
PKVASEMEPEFEFDNSLWLCLRCGNQACGRNKNMHALEHFKTPHSDSHAICVDTTNWSVW
CYDCDEVVNATCKKKLLEAVEYLQKLAEGKSNALPKPAEHQVMDLVPVTSSMSFGNMFNF
TASNVPRPRGLMNLGNTCFFNSVVQCLAQTPYLLNLLQETSEPGQFFQLPGGKLNPQDSD
SPVLEPLTGELEKWRPLMATLAETIVEVNNGRSEAYVPRLLLSKLTARMPQFGGGNQHDS
HELLRHLLEAVREEDLRRYQSVILDRLGLNTKTDPSTVEGEKKKIIKFYGQQASDLLLPT
EQVFRGVLVSTLQCQECQHTSHRDEFFLDLSLPITEKQLPPVLRRKAEEIEDNKPSRHQI
KKEKRAERKKNKKQKSHKNVNIVMGPSNQPTAGLDVDMDKSDSESDADVEDNVEVSEEVT
KGMESGYNSDKVDNSSPDSNNRGISPEMRIDDSGVPSPAIGMLSASHGTPDNSPASSETN
IDMGSPLIDHCSPEEDGNEYFDRPESRLAFVNNKNVDLKTGLSKLSLLNDGDSSKVGTFC
NDKMDDDDNFEGACGGEDPKDEKMDEDDEDVDLWTNTMSARYQCEEGEYSVQSCLNQFTA
CELMTGNNKVSCELCTKRHGGPDKKTVYTNATKQLLIYNPPAVLILHLKRFQVYRFRSAK
VPKFVKFPTLLDLAPFCSKRSQNLPTFEAGQTKVLYSLYGVVEHSGSIHGGHYVAYVKVR
PKLEENSYRWQFLPKNQKNEKGQAPKGAQGEPEVPSGKWYYISDSHVSEASETRVLSAQA
YLLFYERIL
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgcaagaagaagcaccaaggcgaccccacggggggcgaatcgaccgaatcctgc
gacgagaacgacaacatgacggattgccgtcacgtccgccaggccgtggacttgcaaaag
gtcaagaaggccctaatcaagaccggactgaccaccgaatgcgagcaatgcaagaagatg
cccaaagtcgcgtccgaaatggaacccgaattcgagttcgataactcgctatggctgtgt
ttgcggtgcgggaaccaggcctgcggccggaacaaaaacatgcacgccttggagcacttc
aagactccgcactcggactcgcacgccatttgcgtcgatacgaccaactggagtgtctgg
tgttatgactgtgatgaagtcgtcaatgcgacttgcaagaaaaaactgctggaagccgtc
gaatacctccagaagctggccgagggcaagagcaacgcgctgcccaaacccgccgagcac
caagtgatggatttagtcccggtaacttcgagcatgagttttgggaacatgttcaacttc
accgcttcgaacgtacctcgaccgcgtggcttaatgaacctaggcaatacgtgtttcttt
aattcagtagttcaatgtttagctcaaacgccctatttgttaaaccttttacaagaaacc
tccgaaccggggcagtttttccaactaccggggggcaagttgaacccccaggatagcgac
tccccggtacttgagcccttgaccggggagttggagaagtggcgcccgcttatggccacg
ttggccgaaactatagtcgaagtgaacaatggacgcagtgaagcatacgttcctcgttta
cttctctccaaactaaccgctcgaatgccgcagtttggcggcggcaaccaacacgactcg
cacgagctcctgcgccacttactcgaggccgtgcgagaggaggacttgcgccgctaccaa
tcggttatcctcgaccggttaggtttgaacacgaaaaccgacccgagcacggtcgagggt
gagaagaagaaaataatcaagttttacggccaacaagcttccgatctattgctaccaacc
gaacaagttttccgaggggtgcttgttagcacgctgcagtgccaggagtgccaacacacc
tcgcaccgcgacgagtttttcctagatttaagtctaccgatcactgaaaaacaactaccg
ccggttttgcgacgcaaagccgaggaaatcgaggataataaaccgtcacgccaccagatc
aagaaggagaaacgtgcggaaagaaagaaaaacaagaagcaaaagtcgcataaaaacgtc
aatattgtcatggggcccagcaaccagcccacggccgggcttgacgtggacatggataag
tcggatagtgagtcggacgccgacgttgaggacaacgtcgaggtgtccgaggaggtgacc
aaagggatggagtcggggtataattcggacaaggtcgataacagcagccccgactcgaac
aatcgcggtatttcccccgaaatgcgcattgacgacagtggggttcccagtcccgcgatt
gggatgcttagtgcgtcgcacggcaccccggacaatagcccggcctcgagtgagaccaac
atcgacatggggagcccccttatcgatcattgtagtcccgaagaagacggtaatgaatat
ttcgacaggcctgagtcgagactggccttcgtgaacaacaaaaacgtcgatttgaagaca
ggtttgagtaaattaagtctactgaacgatggtgattcgagtaaagttggtacgttttgc
aacgataagatggacgatgatgataatttcgaaggtgcctgtgggggcgaggatccaaag
gatgaaaagatggatgaggacgacgaagacgtggacctgtggaccaacacgatgtcggcg
cgttaccagtgcgaagaaggcgaatactctgtccaatcctgcctcaaccagttcacagct
tgcgaactgatgaccggtaacaacaaagtcagctgcgagctgtgcacgaagcgccacggt
ggccccgataagaaaaccgtctacaccaacgccaccaagcagctccttatctacaacccc
cctgccgttctaatcctgcacttgaagcgtttccaagtgtaccgatttcgctccgccaaa
gtccccaaattcgtcaagttccccacgcttctcgatctcgcgccgttctgttcgaaacgc
tcccaaaacctcccgactttcgaggccggtcagacgaaagtcttgtactctttatacggg
gttgtggagcatagcgggtccattcacgggggccactacgtggcctacgtgaaagtgcgg
cccaagttggaggagaacagctataggtggcagtttttgcccaaaaatcagaaaaacgag
aaggggcaggcgcccaagggggcgcaaggcgagcccgaggtgccctccgggaagtggtac
tatatcagcgattcgcacgtttccgaagccagcgagacgcgggttttgagcgcgcaagcc
tatttgctgttctatgagaggatcttgtaa

DBGET integrated database retrieval system