KEGG   Tribolium castaneum (red flour beetle): 655219Help
Entry
655219            CDS       T01046                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 16
  KO
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.4.19.12]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Enzymes [BR:tca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     655219
Peptidases [BR:tca01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   655219
Ubiquitin system [BR:tca04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    655219
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
LG8
AA seq 824 aa AA seqDB search
MTDCRHVRQAVDLQKVKKALIKTGLTTECEQCKKMPKVASEMEPEFEFDNSLWLCLRCGN
QACGRNKNMHALEHFKTPHSDSHAICVDTTNWSVWCYDCDEVVNATCKKKLLEAVEYLQK
LAEGKSNALPKPAEHQVMDLVPVTSSMSFGNMFNFTASNVPRPRGLMNLGNTCFFNSVVQ
CLAQTPYLLNLLQETSEPGQFFQLPGGKLNPQDSDSPVLEPLTGELEKWRPLMATLAETI
VEVNNGRSEAYVPRLLLSKLTARMPQFGGGNQHDSHELLRHLLEAVREEDLRRYQSVILD
RLGLNTKTDPSTVEGEKKKIIKFYGQQASDLLLPTEQVFRGVLVSTLQCQECQHTSHRDE
FFLDLSLPITEKQLPPVLRRKAEEIEDNKPSRHQIKKEKRAERKKNKKQKSHKNVNIVMG
PSNQPTAGLDVDMDKSDSESDADVEDNVEVSEEVTKGMESGYNSDKVDNSSPDSNNRGIS
PEMRIDDSGVPSPAIGMLSASHGTPDNSPASSETNIDMGSPLIDHCSPEEDGNEYFDRPE
SRLAFVNNKNVDLKTGLSKLSLLNDGDSSKVGTFCNDKMDDDDNFEGACGGEDPKDEKMD
EDDEDVDLWTNTMSARYQCEEGEYSVQSCLNQFTACELMTGNNKVSCELCTKRHGGPDKK
TVYTNATKQLLIYNPPAVLILHLKRFQVYRFRSAKVPKFVKFPTLLDLAPFCSKRSQNLP
TFEAGQTKVLYSLYGVVEHSGSIHGGHYVAYVKVRPKLEENSYRWQFLPKNQKNEKGQAP
KGAQGEPEVPSGKWYYISDSHVSEASETRVLSAQAYLLFYERIL
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atgacggattgccgtcacgtccgccaggccgtggacttgcaaaaggtcaagaaggcccta
atcaagaccggactgaccaccgaatgcgagcaatgcaagaagatgcccaaagtcgcgtcc
gaaatggaacccgaattcgagttcgataactcgctatggctgtgtttgcggtgcgggaac
caggcctgcggccggaacaaaaacatgcacgccttggagcacttcaagactccgcactcg
gactcgcacgccatttgcgtcgatacgaccaactggagtgtctggtgttatgactgtgat
gaagtcgtcaatgcgacttgcaagaaaaaactgctggaagccgtcgaatacctccagaag
ctggccgagggcaagagcaacgcgctgcccaaacccgccgagcaccaagtgatggattta
gtcccggtaacttcgagcatgagttttgggaacatgttcaacttcaccgcttcgaacgta
cctcgaccgcgtggcttaatgaacctaggcaatacgtgtttctttaattcagtagttcaa
tgtttagctcaaacgccctatttgttaaaccttttacaagaaacctccgaaccggggcag
tttttccaactaccggggggcaagttgaacccccaggatagcgactccccggtacttgag
cccttgaccggggagttggagaagtggcgcccgcttatggccacgttggccgaaactata
gtcgaagtgaacaatggacgcagtgaagcatacgttcctcgtttacttctctccaaacta
accgctcgaatgccgcagtttggcggcggcaaccaacacgactcgcacgagctcctgcgc
cacttactcgaggccgtgcgagaggaggacttgcgccgctaccaatcggttatcctcgac
cggttaggtttgaacacgaaaaccgacccgagcacggtcgagggtgagaagaagaaaata
atcaagttttacggccaacaagcttccgatctattgctaccaaccgaacaagttttccga
ggggtgcttgttagcacgctgcagtgccaggagtgccaacacacctcgcaccgcgacgag
tttttcctagatttaagtctaccgatcactgaaaaacaactaccgccggttttgcgacgc
aaagccgaggaaatcgaggataataaaccgtcacgccaccagatcaagaaggagaaacgt
gcggaaagaaagaaaaacaagaagcaaaagtcgcataaaaacgtcaatattgtcatgggg
cccagcaaccagcccacggccgggcttgacgtggacatggataagtcggatagtgagtcg
gacgccgacgttgaggacaacgtcgaggtgtccgaggaggtgaccaaagggatggagtcg
gggtataattcggacaaggtcgataacagcagccccgactcgaacaatcgcggtatttcc
cccgaaatgcgcattgacgacagtggggttcccagtcccgcgattgggatgcttagtgcg
tcgcacggcaccccggacaatagcccggcctcgagtgagaccaacatcgacatggggagc
ccccttatcgatcattgtagtcccgaagaagacggtaatgaatatttcgacaggcctgag
tcgagactggccttcgtgaacaacaaaaacgtcgatttgaagacaggtttgagtaaatta
agtctactgaacgatggtgattcgagtaaagttggtacgttttgcaacgataagatggac
gatgatgataatttcgaaggtgcctgtgggggcgaggatccaaaggatgaaaagatggat
gaggacgacgaagacgtggacctgtggaccaacacgatgtcggcgcgttaccagtgcgaa
gaaggcgaatactctgtccaatcctgcctcaaccagttcacagcttgcgaactgatgacc
ggtaacaacaaagtcagctgcgagctgtgcacgaagcgccacggtggccccgataagaaa
accgtctacaccaacgccaccaagcagctccttatctacaacccccctgccgttctaatc
ctgcacttgaagcgtttccaagtgtaccgatttcgctccgccaaagtccccaaattcgtc
aagttccccacgcttctcgatctcgcgccgttctgttcgaaacgctcccaaaacctcccg
actttcgaggccggtcagacgaaagtcttgtactctttatacggggttgtggagcatagc
gggtccattcacgggggccactacgtggcctacgtgaaagtgcggcccaagttggaggag
aacagctataggtggcagtttttgcccaaaaatcagaaaaacgagaaggggcaggcgccc
aagggggcgcaaggcgagcccgaggtgccctccgggaagtggtactatatcagcgattcg
cacgtttccgaagccagcgagacgcgggttttgagcgcgcaagcctatttgctgttctat
gagaggatcttgtaa

DBGET integrated database retrieval system