KEGG   Tribolium castaneum (red flour beetle): 655239Help
Entry
655239            CDS       T01046                                 

Definition
non-lysosomal glucosylceramidase
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    655239
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    655239
Enzymes [BR:tca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     655239
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG7
AA seq 818 aa AA seqDB search
MSASSDPPQKCVTEVPNYGLKVRLNHTYPENRSQDFKPGLRLIWDMLPLILRYIWYYIVH
RIMGKSIVMDYVHTLRAKQIYGVPIGGIGCGTIGRGYRGEFCRFQLKPGLYEYNTVDANQ
FIVTIKDGHNETIFHSLLSTFPTKSLKSWESLIDGSECFYTGLYPRSWTEYDLSKYGVML
TCRQITPIIPHNYKDSSLPCAMFVWDVKNISEEDRTVTIAFTFKNGVGDKSRDRSSTCSS
KAFTLADSEGVILYHTIDKMQCSYSLAAKTNPQIDISKCLYFDPNSDGIKPWIQLKNNGS
FDKISDKNYGQIFGEMACGIATKATIRAGNTVTSEMALVWDMPSVQFPKKQKKYTRYYTK
HFDGDNTGLRIVRYAFENYQNWERAIYDWQRRILDDENLPDWYKSALFNESYYISDGGAI
WVILDEQEAKKLPKNDPRLEHGKFALLEGHEYKMYNTYDVHFYASFSFVLNFPLLQSILQ
YDMRDAIFTEIPDKVKMLYDGEVCERKVPNTVPHDIGDPGEEPFILLNSYPIHDVSQWRD
LNSKFVLQVFRDAFITGLDDRSIAYLNDMYNACYTVMHKSLDFDVDGDGLIENSGSPDQT
FDTWVMTGASAYCGGLWLAALFAMTKIADALQKTEDKEKFQELLDKGTAAFERKLWNGKC
YNFDCSDKECRSIMADQLCGQWYLRSCGFNYEVFPQDRVKTSLKTIYENNVQSFCDGRMG
AVNGFIDGVIDEFTIQSQEVWTGVTYALAASMLQEGMRTEAFNTAGGMFKSMSERFGLSF
DTPEALYAAKYYRAIGYMRPLSIWSMQLAIDQLNKNVN
NT seq 2457 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctagcagtgatcctccccaaaaatgtgtcacagaagtccccaattacggccta
aaagtgcgcctaaaccacacttatccagaaaaccggtcacaagattttaaacccggtctt
aggctaatctgggacatgctacctctaattttgaggtacatttggtactatattgttcat
agaattatgggaaagtcgatcgttatggactacgtgcacactttgagagcgaaacaaatt
tacggtgtccccatcggtgggatcggttgcggaacgattggaagggggtacaggggcgaa
ttctgccggtttcaactcaaaccagggctttatgagtacaatacagtcgatgccaatcaa
tttattgttacaatcaaagatgggcacaatgagaccatttttcatagtcttttatcaacg
tttccgacaaagagtttaaaaagctgggaaagcctaattgacggttcagagtgtttctat
actggactttacccaagatcgtggactgagtacgacttatcaaaatacggcgtcatgtta
acttgtcggcaaattaccccaatcattccgcataattacaaggatagttccctgccttgt
gcaatgttcgtctgggacgtcaaaaacatctcagaggaggaccgaaccgtcacaatcgcc
ttcactttcaaaaacggcgttggtgataaatcccgcgacagatcttcaacatgtagttca
aaagccttcactctcgccgactccgaaggcgtcattctttaccacacaattgataaaatg
caatgttcctactctcttgccgccaaaaccaacccgcaaatcgacatttcaaaatgtctc
tatttcgacccgaattcagacgggatcaagccctggatccaactcaaaaacaacggcagt
ttcgataaaatcagcgataaaaactacggccaaattttcggcgaaatggcctgtggtatc
gccacgaaggcaaccatccgggccggaaatacggtaacgtcagaaatggccctggtgtgg
gacatgccctcggtccaattccccaaaaaacagaagaaatacaccagatactacaccaaa
catttcgacggcgataacaccgggctgaggatcgtgcgatacgcgtttgagaattaccaa
aactgggaacgggccatttacgactggcagagacggatcctcgacgatgaaaatttgccc
gattggtacaagtcagccctttttaatgagagttactacataagtgacggtggggcaatt
tgggtcattttagacgaacaagaagccaaaaaattgccgaaaaacgaccctagactcgag
cacggtaaatttgcattgttggagggccacgagtacaaaatgtacaacacttacgacgtt
catttttatgcttcattttcgtttgttttaaattttcctttgctccaatcaatcttacag
tacgatatgagagacgccattttcaccgaaattccggataaagttaaaatgttgtatgac
ggggaagtgtgcgagaggaaagtaccaaatacagtaccgcacgatattggagatccaggg
gaagaaccgtttatcttactcaattcgtaccccatccatgacgtaagccagtggcgcgat
ttgaattcaaagttcgttttacaagtgttcagagacgcttttataacaggtcttgacgac
cgatctatcgcgtatttgaacgatatgtacaacgcgtgttacacagtaatgcacaaaagt
ctggattttgacgtggatggagacggccttatcgaaaattcgggaagtcccgaccaaacc
ttcgatacttgggtcatgacaggtgctagtgcgtattgtggggggctgtggttggccgct
ctgttcgctatgactaaaatcgcggacgctttgcaaaaaaccgaagacaaggaaaagttt
caggaattgttggataagggcacagcggcgttcgaacggaaattgtggaacggaaagtgc
tacaatttcgactgttcggacaaagagtgtcgctcgattatggccgatcagttatgcggc
cagtggtatctcaggagttgcggatttaattatgaggtgtttccgcaagatcgggtcaag
actagcttgaaaacgatttacgaaaataacgttcagtcgttttgtgacggccgaatgggg
gctgttaatggatttattgacggggttattgatgagttcactattcagagtcaggaggtg
tggactggggttacctacgccctagctgccagcatgcttcaagaaggaatgaggactgag
gcttttaatactgctggcggaatgttcaagtcaatgagtgagcgatttgggctttccttc
gatactccggaagccttatatgcggcaaagtattacagagcgatcggttacatgcgaccc
ctaagtatatggtcaatgcagttggctattgaccaacttaataaaaatgtaaattaa

DBGET integrated database retrieval system