KEGG   Tribolium castaneum (red flour beetle): 655366Help
Entry
655366            CDS       T01046                                 

Definition
arginase-like
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    655366
  Amino acid metabolism
   00330 Arginine and proline metabolism
    655366
Enzymes [BR:tca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     655366
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEETLEBASE: 
UniProt: 
Position
LG5
AA seq 341 aa AA seqDB search
MFKKGSGVLWQLRKNYSTKIGIVGVPFEEGQGKVGVANGPEAMRKSNLIENIKSIHQEID
VHDYGDVCYTSLENVEVPNMRKYSDVAACNLQVSRTVEKILNDGRICLTLGGDHSIGIGT
VDGHIKAKNEKVCILWVDAHADLNTNKTSVSGNIHGMPLAILVKELADYWPYLPGMDWQK
PVLPIRNVAYIGLRSVDSYERLIIEQFGITAYGMEDVENYGIHNIVNMALDRIDPHRMLS
IHLSFDIDSLDALEAPSTGTAVRGGLTLREGIHLVEQIHKTGRLGAMDLVEVNPSIGSPK
DVQKTVEAAVHLLMAACGYTRRGLIPRGPDGSPIRTIPSPV
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaaaggttcgggtgtgttgtggcaattgcgcaaaaattacagtacgaaaatt
gggattgtgggggtgcctttcgaggaaggtcagggcaaagttggggttgctaacggaccg
gaagcgatgcgcaaatcaaatttaatcgaaaacataaaatcaattcaccaagaaatcgac
gtccacgactacggagacgtctgttacacgtccctggaaaatgtggaggttcccaacatg
aggaaatactcggacgtggcggcttgcaatttgcaggtctcccgaactgtcgaaaaaatc
ctaaacgatggaagaatctgcctaactctaggcggtgaccactcaatcggtatcggcact
gtggatggccacatcaaggccaaaaacgaaaaagtgtgcatactatgggtggacgcacac
gctgacttgaatacgaacaaaacttccgtttcgggaaacatccacgggatgcctcttgcc
atcctggtgaaggagttggccgattactggccgtacctcccggggatggactggcaaaag
cctgtgctaccgatccgaaatgtggcctacattggcttgaggtcggtggattcgtacgaa
aggctcattattgaacagtttgggatcacagcatatgggatggaagatgtggagaattac
gggattcataatattgtgaatatggccttggataggattgacccgcatcgcatgctttcc
atacatttgagttttgatattgatagtttggacgcgttggaggcgccgtccacggggacc
gcagtccgtggaggcctaactctgcgtgaaggcatccacctggtggaacaaatccacaag
acgggccgtctgggggcgatggacttggtggaagtgaatccctccatagggtcccccaaa
gacgtccaaaagacagtcgaggctgcggtccatttgctcatggcagcctgtggctacacg
cgtcgtgggctaataccacgaggacccgacggctcacccatcagaacaattccaagtccc
gtttaa

DBGET integrated database retrieval system