KEGG   Tribolium castaneum (red flour beetle): 655396Help
Entry
655396            CDS       T01046                                 

Definition
GTP cyclohydrolase I-like
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tca00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEETLEBASE: 
UniProt: 
Position
LGUn
AA seq 256 aa AA seqDB search
MTTNGECRANGIRKSKPRPIISRSCSENYEINDVEVPGTPKTPRTSTTPGHEKCTFHHDL
ELDHNPPTREAMLPEMSRSYRLLLESLGENPDRPGLLKTPERAAKAMLFFTKGYDQSLEE
VLNDAIFDEDHDEMVVVKDIEMFSMCEHHLVPFYGKVSIGYLPCGKILGLSKLARIVEIY
SRRLQVQERLTKQIAVAVTKAVQPAGVAVVVEGVHMCMVMRGVQKINSKTVTSTMLGVFR
DDPKTREEFLNLVHSK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaaatggagaatgccgcgcgaatgggattaggaaatcgaaacctagacctata
atctcgcggagttgttccgagaactacgaaatcaacgacgtcgaggtgcccggcactccc
aaaactcctcgcacctccacaaccccaggccatgaaaagtgcacgttccaccacgatcta
gagctggaccataatcccccgaccagggaagccatgctgccggagatgtccaggtcctac
agactgctgctggagtctctgggcgagaatccggacaggcccggactgttgaagactccg
gagagggctgccaaggccatgcttttcttcaccaaaggatacgatcaaagtctcgaagag
gtcttaaacgatgcaattttcgacgaggaccatgacgaaatggtcgtcgtcaaagacatc
gagatgttctccatgtgcgagcaccacctggtgcccttctacgggaaggtgtccatcggg
tacttgccctgtgggaagatcctgggcttgagcaaactggcaaggattgtggaaatctac
tcgcgaaggcttcaagtgcaggagcgattgacgaagcaaattgctgttgctgtgaccaag
gccgtgcaaccggctggtgttgctgttgtagtggagggagtgcacatgtgtatggtgatg
cggggcgtccagaagatcaacagcaagacggtgacctccaccatgttgggggtgtttcga
gacgatcccaagacgcgagaagaattcctcaacttggtgcattccaaataa

DBGET integrated database retrieval system