KEGG   Tribolium castaneum (red flour beetle): 655396Help
Entry
655396            CDS       T01046                                 

Definition
(RefSeq) GTP cyclohydrolase 1
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00790  Folate biosynthesis
tca01100  Metabolic pathways
Module
tca_M00842  Tetrahydrobiopterin biosynthesis, GTP => BH4
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    655396
Enzymes [BR:tca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     655396
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-GeneID: 655396
NCBI-ProteinID: XP_008191045
BEETLEBASE: TC010564
Position
Un
AA seq 232 aa AA seqDB search
MKELAIATNGISPETQIVCPCKNKNGHEKCTFHHDLELDHNPPTREAMLPEMSRSYRLLL
ESLGENPDRPGLLKTPERAAKAMLFFTKGYDQSLEEVLNDAIFDEDHDEMVVVKDIEMFS
MCEHHLVPFYGKVSIGYLPCGKILGLSKLARIVEIYSRRLQVQERLTKQIAVAVTKAVQP
AGVAVVVEGVHMCMVMRGVQKINSKTVTSTMLGVFRDDPKTREEFLNLVHSK
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagctcgccattgcaaccaacggcattagtccggaaacccaaatcgtgtgccct
tgcaaaaacaaaaacggccatgaaaagtgcacgttccaccacgatctagagctggaccat
aatcccccgaccagggaagccatgctgccggagatgtccaggtcctacagactgctgctg
gagtctctgggcgagaatccggacaggcccggactgttgaagactccggagagggctgcc
aaggccatgcttttcttcaccaaaggatacgatcaaagtctcgaagaggtcttaaacgat
gcaattttcgacgaggaccatgacgaaatggtcgtcgtcaaagacatcgagatgttctcc
atgtgcgagcaccacctggtgcccttctacgggaaggtgtccatcgggtacttgccctgt
gggaagatcctgggcttgagcaaactggcaaggattgtggaaatctactcgcgaaggctt
caagtgcaggagcgattgacgaagcaaattgctgttgctgtgaccaaggccgtgcaaccg
gctggtgttgctgttgtagtggagggagtgcacatgtgtatggtgatgcggggcgtccag
aagatcaacagcaagacggtgacctccaccatgttgggggtgtttcgagacgatcccaag
acgcgagaagaattcctcaacttggtgcattccaaataa

DBGET integrated database retrieval system