KEGG   Tribolium castaneum (red flour beetle): 655460Help
Entry
655460            CDS       T01046                                 

Definition
hexosaminidase D
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    655460
Enzymes [BR:tca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     655460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG9
AA seq 548 aa AA seqDB search
MKKLHWFNVSSIGKPLKLFVTFALILTVLFITYFTYLKPKPSPTKVPFQHRIFDEYKHMS
HQETPFKGAKIVHLDLKGAPPKISYYKTLFSLLSKFGATGVLIEYEDMFPYNSPLLKNVS
ALNAYTVEDIHYINKLALENKLEVIPLLQTFGHLEFLLKLEEFSELREVPEYPQVICPTH
EKTLSVLMEMIDQVLQMHPHSKIIHIGADEVYYLGFCDRCANIMNKFNLSKNMLFLEHIN
AITTRIRKKHPHLRILMWDDEFRSFSVKELKSGFLDKGVQPVVWKYSKDVYEELGPSLWE
MYSEVFPKVWIASAFKGATGSNQYVSDVTHYVQNHRSWLSLMSEYSHRITFEGIIITGWQ
RYDHFAVLCELLPVSLPSLAMSLRVIRGYQDSPLSPPTEVAKLLGCEQPYALIGPVFGSP
KCSYTGGDILEGALKLQQLKQEYETILEDSRVKGWMSDYNKNHQFSNPQHVQSVTAPLNR
IKGELMQLDGEMTAAMYEVYDNYTVSEWRETYIKPFEREVRAMVDARDKILAKNYWPRRP
LLQDGDEL
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactccactggttcaacgtatcatccattggcaaacccctaaaattattcgta
accttcgcactgatcctgactgttctttttattacgtattttacttatcttaaacctaaa
ccatccccaactaaagtccctttccaacaccgaattttcgacgaatataaacacatgtct
caccaagaaacgccgttcaagggggctaaaattgtgcacttagacttgaaaggggcccct
ccgaaaatctcgtactacaaaaccctcttttcgcttttatctaaatttggtgcgactgga
gtgttgattgaatatgaagacatgtttccgtacaattctcctttgttgaaaaatgtatca
gcactgaatgcttacacggttgaagatattcactacataaacaagctagcgttggaaaac
aaactggaagtgatcccattgttgcaaaccttcggccatttagagtttctgttgaaactg
gaggagtttagcgaattgcgggaagtaccggagtatccgcaagtgatttgtcccacgcat
gagaaaaccttgagtgttttgatggaaatgatcgaccaagtgttgcaaatgcatccacat
tccaagataattcacattggcgccgatgaagtttactatctgggattttgcgacaggtgt
gccaacattatgaacaaattcaacttgtcaaaaaatatgctgtttttggaacatatcaac
gcaatcactactcgaatacgtaaaaaacatccccacttgcgtattctgatgtgggacgat
gaattcagatcgttcagtgtcaaagaactgaaaagtgggtttttggacaagggcgtccaa
ccagtggtttggaagtactcaaaggacgtctacgaggaattggggcccagcttatgggaa
atgtactcggaggtgttccctaaagtatggatcgcgagcgcttttaaaggagccacaggt
agcaaccagtacgtctctgacgtcacccactacgtccagaaccaccgctcctggctatcc
ctgatgtcggagtactcccacaggatcaccttcgagggcatcatcatcacgggctggcag
cgctacgaccacttcgccgtcctttgcgagcttctcccagtgagtctcccctcactagca
atgagcctccgagtcatccgcggctaccaagactcgcccctgagccccccgaccgaagtg
gccaaacttctaggctgcgagcagccctacgccctcatcgggcccgtgttcggcagcccc
aagtgctcctacacgggcggcgacatcctcgagggggccctcaagctccagcagctcaag
caggagtacgagacgattctagaggactcgagagtcaagggctggatgagcgattataac
aaaaaccaccagttttccaacccgcaacatgtgcagtccgttacagcgcccttgaaccgg
atcaagggcgagttgatgcaactagacggggaaatgacggcagctatgtacgaagtttac
gataattacacggttagtgagtggagagagacgtacattaagccgttcgagagggaggtc
agggccatggttgatgcgagagataaaattttggcgaaaaattattggcccaggaggccg
ttattgcaagacggcgacgagttgtga

DBGET integrated database retrieval system