KEGG   Tribolium castaneum (red flour beetle): 655469Help
Entry
655469            CDS       T01046                                 

Gene name
Clk
Definition
clock (EC:2.3.1.48)
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Circadian rhythm - fly
Class
Organismal Systems; Environmental adaptation; Circadian rhythm - fly [PATH:tca04711]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG3
AA seq 581 aa AA seqDB search
MDDDSDDKDSKRKSRNLSEKKRRDQFNLLVNELSSMVATGSRKMDKSTVLKSTIAFLKNH
NEIAVRSRVNEIQEDWKPTFLTNEEFTHLILEAVDGFIMVFSASGQIFYASESITSLLGH
LPNQVLNMTIYEMANEEEHSHLYNILLTPSEDQGQVSFSCHLRRGDPDSKQNPSFELVHF
VGYFRSDEDMVQSENRYSGYSGEADTRLVFVGTGKIKTPRLIREMPLVDSSKSEFTSRHS
LEWKFLFLDHRAPPIIGYLPFELLGTSGYDYYHVDDLDNIIIGHKALMQKGEGTSCFYRF
LTKGQQWIWLQTRYYITYHQWNSKPEFIVCTHRVVSYVDVMKQNRKEETGVTTSGTSPGT
PWPKNTKSNIRQGTASECTSMSADSPTSRQSVMTQFSVKSESNQPKPPSQMLQPQQPQPL
QPQNQIQPSNHQFLEPPQYVAAIPMQPVISGFSPIQPLDNVMLTPAQTQMQIDLQRKHAE
LQAIIGQQQAELRRVSEQLLMARLGLLPQNQPVQNYSPQVSIAYQGSNSGTVSSTTTTIP
GIQSSAVGSPSLIVPVSISLPIPQHQPNMLYTPSDSNGQTK
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atggacgatgactccgacgataaggactcaaaacggaaatctcgaaacttgagtgagaaa
aaaagacgagaccaatttaatttactagtgaatgagttaagctcgatggtagcaaccgga
agtcgaaaaatggacaaatctactgtccttaaatcaacgatagcttttttaaaaaatcat
aacgaaatagcagtacgatcccgtgttaacgaaattcaagaagactggaaaccgacgttt
ctcacaaacgaagaattcactcatttaatcctcgaagctgtggatggctttattatggtg
ttttcggcttcgggtcaaattttttatgcttcggaaagtattacctcgcttttgggacat
ttaccgaatcaagtcctgaatatgacaatatacgaaatggcaaatgaagaagaacacagt
cacctctacaatattttactcactccgtccgaagaccagggtcaagtttccttctcgtgt
catttgcgacgtggagatcctgactccaaacagaatccctcctttgaacttgtgcatttt
gtaggatatttcagatctgacgaagatatggttcagagcgaaaatcggtatagtggctac
tcgggggaggcagacactagattggtgtttgtgggtactggtaaaatcaagactcctcgc
ttgatccgcgaaatgcccttggtcgactccagcaaaagcgagtttacctcccgccatagc
cttgaatggaaattcctttttctggaccatcgcgctccccctatcatcggctacctcccg
ttcgagcttttaggcacttccggttacgattactaccacgtcgacgacttggacaatatt
ataatcggtcacaaagccctcatgcaaaagggcgagggtacttcttgtttttatagattt
cttacaaaaggccaacaatggatttggttgcagaccagatattacataacctatcatcag
tggaattccaaaccggagtttatcgtttgcacgcatcgtgtcgtaagttatgttgatgtt
atgaaacagaatcggaaggaggagacgggagttacgacatcggggacttccccggggacg
ccatggcccaaaaacaccaagagtaacatacggcaggggacggcgtcggagtgcacctcc
atgtcggcggattcccccacgtcgaggcagtcggtgatgacacagttctcggtgaaatcg
gaatccaaccagccgaagccgccctctcaaatgctccaaccgcagcaaccccaacccctc
cagccccaaaaccagatccaaccctccaaccaccagtttttggaaccacctcaatacgta
gccgccatccctatgcaacccgtcatttcggggttttccccgattcagcctctggacaac
gtcatgctgactccggcacagacccagatgcagatcgacctccagcgaaaacacgccgaa
ctccaagcaatcatcggccaacaacaggcagagttgaggagggtgtctgagcaacttttg
atggccaggttggggcttctaccccaaaatcaacccgtgcaaaattactctcctcaggtg
tccatagcgtatcaaggctcgaattcgggaacagtgagtagtacgaccacgacaattccg
gggattcagtcaagtgctgtgggctcgccgtctcttatagtacctgtaagcatatctcta
ccaatacctcagcatcaaccaaatatgttgtatacgccgtcggattccaatggacaaacg
aaataa

DBGET integrated database retrieval system