KEGG   Tribolium castaneum (red flour beetle): 655510Help
Entry
655510            CDS       T01046                                 

Definition
ubiquitin carboxyl-terminal hydrolase 5
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Enzymes [BR:tca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     655510
Peptidases [BR:tca01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   655510
Exosome [BR:tca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   655510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG3
AA seq 794 aa AA seqDB search
MELLTPHLSSVRVPTATSKVYKDECVFSFDNPETETGLYVGLKSFFGLGRDYVEKHFHKT
GEAVYLHIRRVRHEVSSPPQGDGPEKKITRLAIGVDGGFDPEAMSKKFEFEDSYNIVVLP
GFSTIPWPNTELPQIVKSSIEGILEAPSASKVAEMEALTGTWDGEARVVSQFAHNLPQLD
NGKKIPPSGWQCEKCDKTDNLWLNLTDGSILCGRRFYDGSGGNNHAIEHYNATGHPLAVK
LGTITKEGKGDVFSYKEDDMVEDPNLVQHLAHWGINIANMEKTEKSMVELELELNQKSNE
WSALQESDGQLKPIYGPGYTGMTNMGNSCYLNSVMQMVFSIPDFIQRYYHDAELFFNNVV
GDPCEDFNAQMAKLAVGLHSGKYSVPPPAGSPVDADPPGICPLMFKALVGRGHPEFSTKK
QQDAQEFFLHILTLLERNSKNKVNPGDCFKFKVEEKFQCSASKKVKYLTRSDVLLPLIIP
MDAAINKDEVAAYETKKLEAEKTGKKLLANTIVRPKINFLSCLELFTQSEVINNFYSSAV
NANVTARKTTRLATFPDYLCIQLKKFMLREDWVPIKLDVSIEMPDILDISSLRGTGPQSD
EELLPEPKVQPPAPVMDEGVLAQLADMGFPPEACKRAVFFTHNSGLEAATAWIMEHITDS
DFSDPFVPPGTESSHFTPNAEALASIVAMGFTQHQATKALKATDNNVERAMDWIFSHQDE
LDNVTSPPPPEFRDGDGRYKLVAFVSHMGTSTMVGHYVVHILKNGQWVIFNDNKVALSER
PPKDLGYMYLYERL
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atggaattacttacaccgcatttaagcagcgttagagtcccaacagcgaccagcaaagta
tacaaggacgaatgtgtcttctctttcgataatccggaaaccgagaccggtctgtacgta
ggtctgaagagttttttcggacttgggcgcgattatgttgaaaaacacttccacaaaacg
ggagaagccgtctatctccacatccggcgagtgcgtcatgaagtctcatcacccccacag
ggcgatggacccgagaagaaaatcacgcgcttggccattggagttgacggtggttttgat
ccagaggccatgtcaaagaagtttgagtttgaggactcctacaatattgtcgttttgcca
ggtttcagcaccatcccctggcccaacacagagcttccccaaattgtaaaatcgtctatt
gagggcattttggaagccccctcggccagtaaagtcgccgaaatggaggctttgacgggg
acgtgggatggcgaagctcgggttgtctcccagtttgcccacaacttgccacagttagat
aatgggaaaaaaattccaccttctgggtggcagtgcgaaaaatgtgataaaactgataat
ctgtggctaaacttaaccgatgggtctatcttatgtggcaggaggttttatgatggaagt
ggaggaaataatcacgccattgaacattataacgccaccggtcatcccttagctgttaaa
ttggggacgatcacaaaggaaggaaaaggcgatgtgttcagctacaaggaagacgacatg
gtggaagacccgaatctagtccagcatttagcacactggggaataaatatcgcgaatatg
gaaaaaaccgaaaagtcgatggtcgagctcgagctggaattgaaccaaaaatcgaacgaa
tggtcggctttgcaggaaagcgacggccaattgaaacccatctacggccctggatacact
ggaatgaccaacatgggcaactcctgttacctcaacagcgtgatgcaaatggtattctct
attccagatttcatccaaagatactaccatgacgctgaattatttttcaacaacgtggtt
ggtgacccatgtgaagattttaacgctcaaatggctaaattagctgttggtctacattcg
ggaaaatattcagtcccaccacctgcaggatctcccgtagatgcggatcctccaggaata
tgtcccttgatgttcaaggctttggtgggtcgaggacatccagaattctcaacgaaaaag
caacaagacgcccaggagtttttcctccacatactcactctattggagcggaacagcaaa
aataaagtcaatccgggcgattgttttaaatttaaagtggaggagaaatttcaatgcagt
gccagcaagaaagtcaagtatttgacgaggtctgacgttcttctgccactgatcatccca
atggatgcagccatcaataaagacgaggttgcagcctacgaaacgaagaagctagaggcg
gaaaaaacgggcaaaaaactcctcgctaacaccatcgtgcggccaaaaataaatttcctt
tcgtgtttggaactcttcacgcaatcggaagtcattaacaatttttacagctcggcagtc
aacgcaaacgttactgcccggaaaactacgcgattggcaacatttccagactacctctgc
attcagttaaaaaaattcatgctgagggaagactgggttccgattaaactggacgtttct
attgaaatgccagacattttggacatatcatccctgcgtggtactggcccccagtcggac
gaagagctgcttccggagcccaaagtgcagcccccggcgcctgtgatggacgagggggtc
ctggcacagctggctgacatgggttttccgcccgaggcctgcaaaagagcggtgtttttc
acccataactccggcctggaggcggccaccgcctggatcatggagcacatcacggattcc
gatttttcggacccgtttgttcctcccggcacggagagttcgcactttacgccgaatgcc
gaagctttggcgagtattgtggcgatggggttcacacaacatcaagcaactaaggctctg
aaggcgacggataataatgtggaaagagcgatggattggattttttcgcatcaggatgag
ttggataatgttacgtcaccgccgccgcccgaattcagggacggggacgggaggtataaa
ttggtggcgtttgtttctcatatggggacttcaacaatggtcggccactatgtggtccat
attctcaaaaatgggcaatgggtcatctttaacgacaataaggtggctctgtcggaacgg
cccccgaaggatctaggttatatgtatttatatgagcgactttaa

DBGET integrated database retrieval system