KEGG   Tribolium castaneum (red flour beetle): 655577Help
Entry
655577            CDS       T01046                                 

Definition
similar to glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:tca00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:tca00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:tca00471]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG1=X
AA seq 537 aa AA seqDB search
MRYGENRNEDALFEMFKSEETGLLSIGKFLSALRTTGLRKSDPRLKEMMEAIKRTQKQTD
TQRLNLETFRSIVSPCIGLISRAFRHQFIIPEFQDFCKELEDIYWKCKENTNGKVASYIP
QLKRMNPNYWGVSVCTIDGQRFSIGDVGIPFTIQSCSKPLTYGIALDLLGEEMVHKYVGQ
EPSGRNFNELVLDHNKKPHNPMINAGAILVCALLKTVAGPEMTLAEKFDYTLNYFVRLAG
GEDLGFNNAVFLSEREAADRNYALGFYMREHKCFPEKTNFKECMDFYFQCCSLEMSSDTL
SVMGATLANGGICPLTEEKVLKSESVRDVLSLMHSCGMYDYSGQFAFKVGLPAKSGVSGA
LLVVIPNVMGISLWSPPLDPLGNSCRGVQFCEELVKKFNFHRYDNLLHSTNKSDPRKHKF
ETKGMNVVNLLFSAASGDLPGLRRHKLSGMDMTLADYDGRTALHLAAAEGHIHCVNFLLQ
QCNVQHDIRDRWGRSPLDEALTFGHTAVAEFLQDWDQRYQRSSENMMKAGGTLPGLS
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatggtgagaacaggaacgaggatgcgttattcgaaatgttcaaaagcgaggag
acggggttactctccatcgggaaatttctttcagctttgaggactaccggtttgcgcaaa
agtgatccgcgactgaaagaaatgatggaagctataaagcgcacgcaaaaacagaccgac
actcaacgactaaatttggaaacttttcggagtatcgtatcaccttgtatcggtctgatc
tctcgcgcgttccgccaccagttcataatccccgagttccaagacttttgcaaagaactg
gaggatatctactggaagtgcaaggagaacacgaacggcaaagtggcgtcttatattccg
caattgaaacggatgaatccgaactattggggtgtgagtgtgtgcacaatcgacgggcag
cggttttcgatcggagacgtcggtatcccgttcacgatccaatcctgcagtaagcccctg
acttacgggatcgcgctggatctgctaggggaggagatggttcataaatacgtgggacag
gaaccgagcggccggaatttcaacgagctggtcttagaccacaataagaaaccccataat
cccatgatcaacgctggggcgattctggtctgtgctctcctcaaaaccgtcgccggcccg
gaaatgaccctcgcggagaagtttgactacacgctgaactatttcgtgcgattagcagga
ggggaggatctggggttcaataacgccgtatttttgtcggagagagaggcggctgatcgg
aattacgctttaggtttctacatgagagagcacaaatgttttcccgagaaaaccaatttc
aaggaatgcatggatttttactttcagtgctgttctttggagatgagcagcgatacgctt
tctgtaatgggggccacgttggccaacggcggaatttgcccgttaaccgaggaaaaagtc
cttaaatcggagagcgtccgcgacgtgctatcactgatgcacagctgcggaatgtacgac
tattccggccaatttgcattcaaggtcggtctgcccgcgaagtcgggcgtgagtggggct
ttgctggtggtgatcccaaatgtcatggggatatccctgtggtccccacctctggatcca
ttaggtaatagctgccggggcgtgcagttctgcgaggagttagtaaaaaaattcaatttc
caccgatacgacaatctcttacactcgaccaacaaatctgatcctcgaaaacacaaattc
gagacgaaaggcatgaatgtggttaatttgttgttttcggcggcttctggcgatttgcct
ggacttagaaggcataaactttcgggtatggacatgacgctggccgactatgacggccgc
acggctctgcatttggcagcggcagaggggcatatccactgcgttaatttcctcttgcaa
caatgcaacgtacaacatgatattagagatagatggggacggtctcccttagatgaagca
ctgacgtttggacacacggcagttgcggagtttttacaagactgggaccagcgatatcaa
agatcttcggaaaatatgatgaaggccggtggaactcttccggggcttagctaa

DBGET integrated database retrieval system