KEGG   Tribolium castaneum (red flour beetle): 655770Help
Entry
655770            CDS       T01046                                 

Definition
histone deacetylase 7
Orthology
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Enzymes [BR:tca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     655770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG5
AA seq 807 aa AA seqDB search
MAEQQREAPERELEQQILQIKKQHQLQHQILLQHFQQQQKHLAEQHEQQLRQHLKEFWER
QKQLQELRQREQLEALRKKEKHEESAVASTEVKHKLQAFLRQRASGCSKTSRTDNSCWSE
GMDTGSDSTTNNDFPLRKTASEPNLLKVRLKQRVMERRCSPMSKRHLPPSLKKKLLSSCL
PPSESPPQEPPKELSPPCETEEYQRHALFSSPSMPNISLAAHHVLSPDLSEAAVRAACTA
RLGMPLTGQMLPGTLPFYPSLPAIESEHEETPLDTISELQEPQQSRGVIRPLGRTQSSPL
PLGHPLLEGPPPPVPQPPQPPPEEQEQRDLELRANESRSIRPLSRALSSPVVHLGAPDGP
TLSRRRASSTPTTGLAYDSQMLKHACICGNNAIHPEHAGRLQSIWSRLLETGLVSRCDRL
RPRKASTTELQMCHSEAHALLYGTSSMNRHKMDMSKLSSLPVTAFVRLPCGGIGVDTDTT
WNEVYTAPAARMAVGCTVDLAVRTWTGDIRNGFAVVRPPGHHAEPQQAMGFCFFNSVAIA
ARVLQREHRVHKILIFDWGVHHGNGTQDIFYDDPRVLVISMHRHDDGNFFPGTGSPGECG
AGAGVGFNVNIAWSGGLNPPLADADYLAAFRAIVMPIAREFNPDIVLVSAGFDATDGHLP
PLGGYKVSAACFGHMTRQLMQLARGRVVLALEGGYDLPSICDSAEECVRVLLGDSPSPIA
PSELARAPCGNAVLALQKVISVQSAHWPCLQEAAKSAGCSFNDAVRNEKDDKDTVNAMAS
LSMQHNMVGSPPGFHPGCSPDAGRPSA
NT seq 2424 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcagcagcgagaggcgccagagcgcgagctcgagcagcaaatcctccagatc
aagaagcagcaccagctccagcaccagatcctgctgcagcacttccagcagcagcagaag
cacctcgctgagcagcacgagcagcagctgcggcagcacctgaaggagttctgggagcgc
cagaagcagctgcaggagctgcgccagagagagcagctggaggcgctgcgcaagaaggag
aagcatgaggagagcgccgtcgcctccaccgaagtcaagcacaagctgcaggcgttcctc
agacaaagggcgtcgggatgctccaagacgtccaggacggacaattcctgctggtcagag
ggaatggatacagggtctgactcaacaactaacaacgattttcccttaaggaaaacagca
tccgagcctaatctgctgaaagtgcggttaaagcagcgcgtgatggagcgccgctgcagc
cccatgagtaaaagacaccttcccccgtcgctcaagaagaagctcctgagctcgtgcctg
ccgcccagcgagtcgccgccccaagagccccccaaagaactgagtcccccgtgcgagacc
gaagaatatcaacgacatgcccttttcagcagtccatcgatgccgaatatttctttagcc
gcccaccacgtcctctcgcccgacctgtcggaggcggccgtccgggccgcctgcaccgcc
aggctgggaatgcccttaacgggccaaatgctgcccgggactctgccgttttatccctca
ctaccggcgattgagagcgagcacgaggaaacccccctggacacaattagcgaattacag
gaacctcagcagtcgaggggggtgatccggccgctgggaaggacgcagtcttcgccgctt
cctctaggacatccgctgctggaggggccgccgcccccggtgccccagccgccgcagccc
ccgcccgaagaacaggagcagagggacctggagctcagggccaacgaatcgcgaagcatt
cgccccctgtctcgtgccctgagcagccccgtggtgcacctgggcgcccccgacgggccg
acgctctctcgtcgtcgcgcctcctccaccccgacaacgggcttagcatacgacagccag
atgctgaaacacgcctgcatttgcggcaacaacgccatccacccggagcacgctggccgc
ctccagagcatctggtcgcgtctcctcgaaacgggtctcgtgtctcggtgcgaccgcctc
cggccacgcaaagcctccaccacggagctgcaaatgtgccactcggaagcgcacgctttg
ctctacggcaccagctccatgaaccggcacaagatggacatgagcaaactcagctctctc
cccgtcacggccttcgtgcgtctgccgtgcggcggcatcggcgtcgacaccgacaccacc
tggaacgaggtgtacacggctccggccgcgcgcatggccgtcggctgcaccgtggacctg
gcggtccggacctggaccggcgacatcaggaacggcttcgcggtggtgcggcccccgggc
caccacgccgagccccagcaggccatgggcttctgcttcttcaactcggtggccatcgcc
gccagggtgttgcagcgcgagcaccgcgtccacaagatactcattttcgactggggcgtc
caccacggcaacggcacccaggatatcttctacgacgatccccgggtcctcgtcatctcg
atgcatcgccacgatgacgggaattttttcccggggaccgggagcccgggggagtgcggc
gcgggcgctggggtggggttcaacgtgaacatcgcgtggtcaggggggctcaacccgccc
ctggcggatgccgattacttggcggcgtttcgcgcgatcgtgatgccgatcgcgcgcgag
ttcaaccctgacatcgtcctggtgtccgccggtttcgacgccacggacgggcacctgccc
ccgctcgggggctacaaggtgtcggcggcgtgcttcgggcacatgacgcggcagctgatg
cagctggcgcgggggcgggtcgtgctggcgctcgagggcggctacgacctgccctcgatc
tgcgactcggccgaggagtgcgtgcgggtgctgctgggggacagtccgtcgccgatcgcg
ccgtcggagttggcgagggccccgtgcgggaacgccgtcctcgcgctccagaaagtgata
agcgtacaaagtgcccattggccgtgtttgcaggaggccgccaagtcggccgggtgttct
ttcaacgacgctgtgcgcaacgagaaagacgataaggatacggttaatgccatggcgagt
ctttcgatgcaacataatatggtggggtcgccgcctgggtttcatccagggtgttcgccg
gacgcaggtcgtccgtctgcatga

DBGET integrated database retrieval system