KEGG   Tribolium castaneum (red flour beetle): 655957Help
Entry
655957            CDS       T01046                                 

Definition
uroporphyrinogen iii synthase-like
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    655957
Enzymes [BR:tca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     655957
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG9
AA seq 250 aa AA seqDB search
MTVLKNTVLLLKSDTTDDKYTKLLQARNFKVMAVKTLVFEYKNAAILREKLLSADKYSGI
LLSSPRCVSAVSQALEKRLVQELWGPKSNYTVGESTYKEALDKLGVECQGKESGNAKNLA
QLIIQSKAQFTKPFLFPHGNLKTDTLKLELGRENLQIEGVLVYDTLPNPDIAQELSECTN
NFTDIPEFVIYFSPSGLHSSIEYLRKLLTDRGVKIIAIGPVTELALQDLNLTVHAVAKSP
TPEEVIKTLT
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgactgtgctgaaaaatacagtgcttttgctcaagtctgacacgactgacgacaaatat
acgaagttattgcaagccaggaattttaaggttatggctgtcaaaacattggtctttgaa
tacaaaaatgcggctattttgcgagagaaattgctaagcgctgataaatacagtggaatt
ttgttgtctagtccccgttgtgtaagtgcagtaagccaggctttggagaaaaggctggta
caagagttgtggggccccaaatcaaactatacagtaggcgaaagtacgtataaagaggct
ctggataagttgggggtcgagtgtcaggggaaggagagtggtaatgccaaaaacttggca
caacttatcattcaaagtaaggcacaatttacgaaaccttttctcttccctcatggaaac
ttaaagactgatactctcaagttggaactagggagggaaaacctgcaaattgagggcgta
cttgtctatgacacccttccgaacccagatattgcgcaagaattgtccgagtgcacaaac
aattttacagatattcctgaatttgtgatatattttagcccctcaggcttgcacagtagt
atcgaatacttgcgtaaattgcttaccgaccggggtgtaaagattattgccataggacct
gtgactgaattagccctgcaagacctaaacctcacagtgcatgccgtggccaagagcccc
acccccgaggaagtaataaaaaccctcacgtga

DBGET integrated database retrieval system