KEGG   Tribolium castaneum (red flour beetle): 656027Help
Entry
656027            CDS       T01046                                 

Gene name
Fdl
Definition
fused lobes
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    656027 (Fdl)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    656027 (Fdl)
   00603 Glycosphingolipid biosynthesis - globo series
    656027 (Fdl)
   00604 Glycosphingolipid biosynthesis - ganglio series
    656027 (Fdl)
   00511 Other glycan degradation
    656027 (Fdl)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    656027 (Fdl)
Enzymes [BR:tca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     656027 (Fdl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG7
AA seq 630 aa AA seqDB search
MKPGELKRVLFFFSFCCILFFIYLYWQQTSNLTTSKLLYTYRQPYPRQKKSHPPQWTWQC
INQRCERRHIKGAIPVVSLSTCSMLCGSTQLWPQPTGPVTLASRAVTFNHQQLELETDTP
EPARTLLEHSFVAFNTNIISLVQNKDYVERDTDIRRFLIKVTILHPNIVKLKLDTSEGYT
LSVKPRDGEIVANITAKTFFGARHGLETLSQLIWWDDYETKGALKVLKGATVQDNPIFPY
RGIMLDTARNYMSVESIRRVLDGMAANKLNVFHWHLTDSQSFPLVSQRVPQLAKNGAYGP
DMIYTPEDVKALVEYARIRGIRVVLEVDTPAHAGNGWNWGPQEGLGELAVCVNERPWSLY
CGEPPCGQLNPDNPNVYEILEKLYKDLLELSDETELFHLGGDEVNLECWAQHLQKTTTFM
NYTDLHDLWGEFTLKALKRLERANNGVKIPLVIIWSSNLSKRPYIYKYLDKKNVVVQSWG
ASQWPDTPDLISDGYRVIISHVDAWYLDCGFGRWRETGEAACDPYRPWQTVYNHRPWQQL
HLNKKQILGGEACLWSEQFDETSLDTRLWPRAAAFAERVWSDPQLDVTSFTIQEDVYTRL
NTHRDRLVARGLGAEAMWPVWCAQNPGMCL
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctggcgagcttaagcgtgtcctcttctttttttccttctgctgtattttattc
ttcatttatctgtactggcaacaaaccagcaatcttaccacgtcgaagcttttgtacact
tatagacaaccctacccccggcagaagaagtcgcacccgccccagtggacttggcaatgt
ataaatcagcgatgcgagaggcggcatataaaaggggccatccctgtagtgtcattatcg
acatgcagcatgttgtgcggctcgacgcagctctggccccaacccaccggacctgtaact
ctcgccagcagggctgtcacattcaaccatcaacaattagagctcgaaacggacactccc
gaacccgctagaacacttttagagcattctttcgtggccttcaatactaacattatcagt
ctagtccaaaacaaagattacgtagaacgagacaccgacattagaagatttctaatcaaa
gtcacaattttgcacccgaatatcgtaaaactaaagctggatacgagcgaaggctatacg
ttgagtgtgaagccacgggacggcgaaattgtggccaatatcacggcgaaaacttttttc
ggggccaggcacgggctcgagactttgtcccagttgatttggtgggacgattatgaaacc
aagggggcgctcaaggtacttaaaggggccacggtccaggataatcccatttttccctac
cgtgggattatgctggatacggcgaggaattacatgagtgttgagagtattcgacgagtg
ttggacggaatggccgcgaataaactcaatgtcttccactggcacctcaccgactcccag
agttttcctttggtgtcacaaagagtgcctcagttggccaaaaacggtgcctacggaccc
gacatgatctacacgccggaagacgtcaaggctttggtcgaatatgcccgaatcagaggc
atccgagtggtgcttgaagtggatacaccggcccacgccggcaatggttggaattggggc
ccccaggaagggctaggcgaactagcagtgtgtgtcaacgagcgcccctggagcctgtac
tgcggggagcccccatgtggccaactcaaccccgacaaccccaacgtttacgaaatcctc
gagaaactgtacaaagacttgttagaattaagtgacgaaacggagctcttccatttggga
ggagacgaggtgaatttggagtgttgggcccaacacttgcaaaaaaccacgactttcatg
aactacaccgacttgcacgacctttggggcgagttcaccctcaaggcgttaaaacgattg
gaacgggccaataacggggtaaagatcccgcttgtgataatctggtccagcaatctcagc
aagagaccctacatttacaaatatttagataagaaaaacgtcgtggtgcagagttggggg
gcgagccagtggccggacacccccgacctcatcagcgacggctaccgggtgatcatctcg
cacgtggacgcgtggtacctcgactgcggtttcgggcggtggcgtgagacgggggaggcg
gcgtgtgacccataccggccgtggcagaccgtctacaaccaccggccgtggcagcaactg
cacctcaacaagaagcagatcctggggggcgaggcctgtctctggagcgagcagttcgac
gagacgtcgctcgatacgaggctgtggccgagggcggccgccttcgccgagagggtgtgg
agcgacccgcagctggatgtaacctcgtttaccatccaggaggacgtctacacgaggttg
aacacgcatagggaccggttggtggcccgggggctgggggcggaggccatgtggccggtg
tggtgtgcgcaaaatcccggtatgtgcctttga

DBGET integrated database retrieval system