KEGG   Tribolium castaneum (red flour beetle): 656048Help
Entry
656048            CDS       T01046                                 

Definition
protein disulfide-isomerase TMX3
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Enzymes [BR:tca01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     656048
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG3
AA seq 440 aa AA seqDB search
MHKNRLIKSSNMYGYLAVFCALLAHCSASRVLELSDKFSEIYKEGGFWLVKFYAPWCGHC
KRLEPVWAQVAQALYKTNIRVGRVDCTRFPTLATEFSVNGFPTIKFIKPGEDFTFHGDRS
KDDIVNFAIRMAGPPVQDVTRSESLTNLKQMNQLFFMYVGDQEGLLWEAYYDVASKLQPH
GFFYAASKEIAKQHVDVDELPAVFVYKESLHYFYPIESGPVDLNESEEAQHLNSSMYKWI
NEERFETFPKITRGNINEILQTKKYIVLVVVEENKLQQISQEMLEFRDMVESIIRKKRDK
YHKHFQFGWVGNPELANSIAMQVLPLPHLLVLNSTTNHHHIPEDDPSQLTADAIDIFLER
IYNQSVPAYGGNSITVRLYRTYFEARTSLADMWRGNPVLTTVLFGLPLGFLSLILYSICC
SDILDADEDEEEELLHEKKE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagaatcgactaataaaatcgtcaaacatgtacggttatttggcagttttttgt
gctctgttggcccactgttccgcttccagagtcctagaattaagcgacaaattctccgaa
atttacaaagagggtggcttctggttggtcaaattctacgccccgtggtgtggtcattgc
aaaagattggagccggtttgggcacaggttgcccaagcgttgtataaaaccaacataaga
gttggtagagtggactgtacgaggtttccaacattagccaccgaattttccgtaaatggc
ttccccactatcaagtttattaagccaggtgaagattttacatttcatggggacagaagc
aaagacgatattgttaattttgccatcagaatggctgggccacctgtgcaagatgtgacg
agatcagagagtttaacaaacttgaagcaaatgaatcagttgtttttcatgtatgtgggg
gaccaggaggggctgctgtgggaggcctactacgatgttgctagtaaattgcaaccgcat
gggtttttctacgccgctagcaaggaaattgcgaaacaacatgttgatgttgatgaattg
ccggctgtttttgtgtataaggaaagtttgcattacttctatccaattgaatcaggccca
gttgatttgaacgaatccgaggaagcacaacacttgaattcttccatgtataaatggata
aacgaagagcggtttgaaacgttcccaaaaatcacaagaggcaacataaacgagattctc
caaacgaaaaagtacattgtcctggttgttgttgaagaaaataaattgcaacaaataagt
caagagatgttggaatttagagatatggtcgagtccatcatacggaagaaaagggataaa
taccataaacattttcaatttggttgggttggtaaccctgaattggcaaacagcatagca
atgcaggtcttaccattgccgcatttgttggttttaaattcaaccacaaaccaccatcat
atccctgaagatgatccatctcagttgactgcagatgctattgatattttccttgaaaga
atatacaatcaaagtgtaccagcttatggcggaaatagtataaccgttcgcctctataga
acatactttgaggcaagaacatcactggctgacatgtggcggggaaatcctgtcttgaca
acagtcctttttggtctgcctcttggctttctctccttgatattgtactcaatttgttgt
tccgatattttggacgcggatgaagatgaggaagaagaattattacacgagaaaaaagag
taa

DBGET integrated database retrieval system