KEGG   Tribolium castaneum (red flour beetle): 656066Help
Entry
656066            CDS       T01046                                 

Definition
purine biosynthesis protein 6, pur6-like
Orthology
K01587  
phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Purine metabolism
Metabolic pathways
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    656066
Enzymes [BR:tca01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.21  phosphoribosylaminoimidazole carboxylase
     656066
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     656066
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG10
AA seq 424 aa AA seqDB search
MATVKQVGDYKLGALIIEGKTKQVYELPGSPDLCLLLNKDRITAGDGVKAHDLAGKAAIS
NKTNGKVFEILNSVGVKTSFVKAASDVAFISKKCEMIPIEWVTRRLATGSFLKRNPGVPE
GYRFFPPKHETFFKDDANHDPQWSSEQIISAKFKVNGLEIGPTEVDIMTRMSILVFEILE
KVWASRNCALIDMKIEFGVDKSGEILVADVIDSDSWRLWPSGDKRLMVDKQVYRNLTTVT
SSDLDTVKRNFEWIVDQLDHLAPPNDHLVVILMGSPSDADHCKTIQKHCEKLGLNTELRV
TSAHKGTEETIKIIRYYESLPLKVVFIAVAGRSNGLGPVVSGNSPFPVINCPPLKAENVD
RDVWSSLNVPSGLGCSTVLYPEAAALSAANIIGLGNYVVWSRLRVRQLDNYVTLAKADKG
VKNN
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggtcaaacaggtcggtgactacaaattgggggccctcatcatcgagggcaag
accaagcaagtgtacgagttgccgggatcccccgatttgtgccttttgctgaataaggac
cggatcacggcaggcgatggcgtcaaagcgcacgatctggcgggaaaggcggcaatttcg
aataagacaaatggaaaagttttcgaaattttaaattcagtcggggtgaaaacttcgttc
gttaaagccgcctctgatgtggcttttatttcgaaaaagtgtgagatgatccccattgag
tgggtgacaaggcgtctggcgactggttccttcctgaagcggaatccgggggttcccgag
ggatacaggtttttccccccgaaacacgagacttttttcaaagatgacgcaaaccacgac
ccccaatggtccagcgagcagattatctcggcgaagttcaaggtcaatggcttggagatt
gggcccactgaggttgatatcatgacgcggatgtcgattttggtttttgaaattttggaa
aaagtctgggcgtctagaaattgcgctcttatcgatatgaaaatagaattcggtgtcgac
aaatcaggggaaatcctcgtggccgacgtcatcgactcggacagctggcggctgtggccc
tccggggacaagcgcctcatggtcgacaagcaagtctaccgtaacctcaccaccgtcacc
tcctccgacctggacaccgtcaagcgcaacttcgagtggatcgtcgaccagctggaccac
ctcgccccgcccaacgaccacctggtggtcatcctcatgggcagcccctcggacgccgac
cactgcaaaaccatccagaaacactgcgaaaaactcggtctcaacaccgaactgcgcgtc
acctcggcacacaaaggcacagaagaaacgatcaaaattatcagatattacgagtctctc
cctctgaaggtcgtttttatcgcagtggcgggccggtccaacggcttgggaccagtggtt
tcggggaattccccgttcccggtcattaactgtcccccacttaaggccgaaaatgtggac
agggacgtgtggtccagcttgaatgtgccctcggggctggggtgcagtacggtcctgtat
cccgaagctgccgccttaagtgcggccaatattatcgggctgggaaattatgtggtctgg
agtaggctgagagtgagacagttggataattatgtcactctggccaaggctgataagggg
gtgaagaataattga

DBGET integrated database retrieval system