KEGG   Tribolium castaneum (red flour beetle): 656089Help
Entry
656089            CDS       T01046                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme L5-like
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Enzymes [BR:tca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     656089
Peptidases [BR:tca01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   656089
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG3
AA seq 323 aa AA seqDB search
MSEAAGNWCLIESDPGVFTELIREFGVKGVQVEELWSLEPEQFEKLKPIHGLIFLFKWTK
DDEPSGSIVQDSRLEKIFFAKQVIENACATQAILSVLLNCRHADLKLGHTLTELKDFCQG
FDANMKGLTISNSPVIRSVHNSFARQQIFEFDPSLANKNEDVFHFVSYVPIDGRLYELDG
LKTGPIDLGPLTADSDWTDVVRPIIEKRIQRYTEGEIHFNLMAIVSDRKMLYQRQIDNLQ
KKLEESGMETDSQQAEIARLRLLIEDEENKRRQYRVENIRRKHNYLPLIVEILKILAKEG
KLMTLYEQAKQKTLKKQKAKMSS
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagcggccggaaattggtgcttgatcgaaagcgatcccggtgtcttcacagaa
ttaatccgcgagtttggggtaaaaggcgtccaagtggaagaactgtggagtctcgagcca
gaacagtttgaaaaattgaagcccatccacggtctcatattcctgttcaagtggacaaaa
gacgacgaacccagcggctcgatcgtgcaagacagccgtttagaaaagatttttttcgcc
aaacaagtgatagaaaacgcttgtgcaacacaggcgattttgagtgttttattaaactgt
cggcacgccgatttaaagttaggtcacactttaactgaactcaaagatttctgtcaaggt
tttgatgcaaatatgaaaggcttaactataagtaattcgcctgttattaggtcggttcat
aattcttttgctagacagcaaatttttgaatttgatccttctttggctaacaaaaatgag
gatgtttttcattttgttagttatgtgcctatagatggcagactttatgaacttgacggc
ctcaaaacggggcccatcgacctggggccgctcacagccgactcggactggacggacgtg
gtccggcccatcatcgagaagaggatacagaggtatacggagggcgagattcatttcaat
ttgatggcgatagttagcgaccgaaaaatgctctatcaaaggcaaatagacaatttacaa
aaaaaactagaggagtctgggatggaaaccgactcgcaacaagcggaaattgcgcgcctg
cgtctgcttattgaagacgaggaaaataaaaggcgtcagtatcgcgtggaaaatattagg
cgcaaacacaactatttgcctttgatagtggagattttgaaaattttggccaaagaagga
aaactaatgacgctgtatgaacaagccaaacaaaaaaccttgaaaaaacaaaaggcaaaa
atgtcgtcttaa

DBGET integrated database retrieval system